BLASTX nr result
ID: Lithospermum22_contig00044604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044604 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266682.2| PREDICTED: probable LRR receptor-like serine... 92 3e-17 emb|CBI22150.3| unnamed protein product [Vitis vinifera] 92 3e-17 ref|NP_194004.1| leucine-rich repeat protein kinase-like protein... 92 6e-17 ref|XP_002509606.1| leucine rich repeat receptor kinase, putativ... 90 2e-16 ref|XP_002869809.1| hypothetical protein ARALYDRAFT_492596 [Arab... 89 3e-16 >ref|XP_002266682.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180 [Vitis vinifera] Length = 813 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +3 Query: 57 ILGNSELRALMVIKASLDPENKHLSSWNMEGDPCSGAFEGVACNEHRKVSNITLQGE 227 + GNSELRALM +KASLDP N+ LSSW + DPCSG+FEGV CNEHRKV+NITLQG+ Sbjct: 25 VWGNSELRALMEMKASLDPVNRFLSSWTSDADPCSGSFEGVHCNEHRKVANITLQGK 81 >emb|CBI22150.3| unnamed protein product [Vitis vinifera] Length = 680 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +3 Query: 57 ILGNSELRALMVIKASLDPENKHLSSWNMEGDPCSGAFEGVACNEHRKVSNITLQGE 227 + GNSELRALM +KASLDP N+ LSSW + DPCSG+FEGV CNEHRKV+NITLQG+ Sbjct: 25 VWGNSELRALMEMKASLDPVNRFLSSWTSDADPCSGSFEGVHCNEHRKVANITLQGK 81 >ref|NP_194004.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|2827550|emb|CAA16558.1| leucine rich repeat receptor kinase-like protein [Arabidopsis thaliana] gi|7269119|emb|CAB79228.1| leucine rich repeat receptor kinase-like protein [Arabidopsis thaliana] gi|38564276|gb|AAR23717.1| At4g22730 [Arabidopsis thaliana] gi|51971929|dbj|BAD44629.1| leucine rich repeat receptor kinase-like protein [Arabidopsis thaliana] gi|224589626|gb|ACN59346.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332659245|gb|AEE84645.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Length = 688 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/67 (62%), Positives = 54/67 (80%), Gaps = 2/67 (2%) Frame = +3 Query: 33 LNHFLVTP--ILGNSELRALMVIKASLDPENKHLSSWNMEGDPCSGAFEGVACNEHRKVS 206 L+ FL TP + GN+EL+ALM +K+SLDPENK L SW GDPC G+FEG+ACN+H KV+ Sbjct: 12 LSIFLATPSNVRGNAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVA 71 Query: 207 NITLQGE 227 NI+LQG+ Sbjct: 72 NISLQGK 78 >ref|XP_002509606.1| leucine rich repeat receptor kinase, putative [Ricinus communis] gi|223549505|gb|EEF50993.1| leucine rich repeat receptor kinase, putative [Ricinus communis] Length = 693 Score = 90.1 bits (222), Expect = 2e-16 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = +3 Query: 57 ILGNSELRALMVIKASLDPENKHLSSWNMEGDPCSGAFEGVACNEHRKVSNITLQG 224 + GN+ELRAL+ +K++LDP NK L SW +GDPCSG+FEGVACNEHRKV+NI+LQG Sbjct: 38 VCGNTELRALIELKSALDPTNKFLQSWAADGDPCSGSFEGVACNEHRKVANISLQG 93 >ref|XP_002869809.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. lyrata] gi|297315645|gb|EFH46068.1| hypothetical protein ARALYDRAFT_492596 [Arabidopsis lyrata subsp. lyrata] Length = 687 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 2/67 (2%) Frame = +3 Query: 33 LNHFLVTP--ILGNSELRALMVIKASLDPENKHLSSWNMEGDPCSGAFEGVACNEHRKVS 206 L+ F TP + GN+EL+ALM +K+SLDPENK L SW GDPC G+FEG+ACN+H KV+ Sbjct: 12 LSIFFSTPSNVRGNAELKALMELKSSLDPENKLLRSWTFNGDPCDGSFEGIACNQHLKVA 71 Query: 207 NITLQGE 227 NI+LQG+ Sbjct: 72 NISLQGK 78