BLASTX nr result
ID: Lithospermum22_contig00044337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044337 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149110.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 69 5e-10 ref|XP_003624687.1| 2-aminoethanethiol dioxygenase [Medicago tru... 65 8e-09 gb|AFK44841.1| unknown [Medicago truncatula] 65 8e-09 ref|NP_001241359.1| uncharacterized protein LOC100819405 [Glycin... 62 5e-08 ref|XP_003554039.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 61 8e-08 >ref|XP_004149110.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Cucumis sativus] Length = 278 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -1 Query: 148 IRRQIEVVPRTLERLFITCCEVFKGHGTVPCPDDVQKLCHFLDNMMPED 2 IRR I VVP L+ LF++C EVFKG GTVP P DV+KLC LDNM ED Sbjct: 34 IRRSIPVVPMALQELFVSCREVFKGPGTVPLPCDVEKLCRILDNMKAED 82 >ref|XP_003624687.1| 2-aminoethanethiol dioxygenase [Medicago truncatula] gi|87162727|gb|ABD28522.1| Cupin, RmlC-type [Medicago truncatula] gi|355499702|gb|AES80905.1| 2-aminoethanethiol dioxygenase [Medicago truncatula] Length = 283 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -1 Query: 151 NIRRQIEVVPRTLERLFITCCEVFKGHGTVPCPDDVQKLCHFLDNMMPED 2 N RR + VP+ L+ LF +C + FKG GTVP P DV KLCH LDNM PED Sbjct: 35 NHRRVKKHVPKALQELFDSCKQTFKGPGTVPSPRDVHKLCHILDNMKPED 84 >gb|AFK44841.1| unknown [Medicago truncatula] Length = 283 Score = 64.7 bits (156), Expect = 8e-09 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = -1 Query: 151 NIRRQIEVVPRTLERLFITCCEVFKGHGTVPCPDDVQKLCHFLDNMMPED 2 N RR + VP+ L+ LF +C + FKG GTVP P DV KLCH LDNM PED Sbjct: 35 NHRRVKKHVPKALQELFDSCKQTFKGPGTVPSPRDVHKLCHILDNMKPED 84 >ref|NP_001241359.1| uncharacterized protein LOC100819405 [Glycine max] gi|255641533|gb|ACU21040.1| unknown [Glycine max] Length = 301 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 127 VPRTLERLFITCCEVFKGHG-TVPCPDDVQKLCHFLDNMMPED 2 VP+ L+ LF++C E FKG G TVP P DVQKLCH LD+M PED Sbjct: 59 VPKALQELFVSCRETFKGPGGTVPSPQDVQKLCHILDSMKPED 101 >ref|XP_003554039.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Glycine max] Length = 281 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -1 Query: 148 IRRQIEVVPRTLERLFITCCEVFKGHGTVPCPDDVQKLCHFLDNMMPED 2 +RR V +TL +LF +C E FKG GTVP P DVQ+L H LDNM PED Sbjct: 37 VRRPELSVSKTLHQLFDSCREAFKGPGTVPSPQDVQRLTHILDNMKPED 85