BLASTX nr result
ID: Lithospermum22_contig00044064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044064 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsi... 56 3e-06 gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. ... 55 8e-06 emb|CAB43904.1| putative protein [Arabidopsis thaliana] gi|72697... 55 8e-06 >gb|AAC67200.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1402 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = -2 Query: 167 SPSLWHLRLGHPWPDVLQRLVSNKKIDYNSFSRNILCNICELGNQSKLPFSVSN 6 S +WH RLGHP P VLQ+LV I N S++ LC C+LG ++LPF S+ Sbjct: 463 SDEVWHRRLGHPHPQVLQQLVKTNSISINKTSKS-LCEACQLGKSTRLPFVSSS 515 >gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 2301 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = -2 Query: 176 VHKSPSLWHLRLGHPWPDVLQRLVSNKKIDYNSFSRNILCNICELGNQSKLPFSVS 9 V S +WH RLGHP P +LQRL S K + N S++ LC C++ S+LPFS S Sbjct: 458 VAASDEVWHQRLGHPNPHILQRLASIKSVFINKRSKS-LCVSCQMAKSSRLPFSAS 512 >emb|CAB43904.1| putative protein [Arabidopsis thaliana] gi|7269745|emb|CAB81478.1| putative protein [Arabidopsis thaliana] Length = 1415 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/54 (48%), Positives = 37/54 (68%) Frame = -2 Query: 167 SPSLWHLRLGHPWPDVLQRLVSNKKIDYNSFSRNILCNICELGNQSKLPFSVSN 6 S +WH+RLGHP DVLQ+L+ NK I + S + LC+ C++G KLPF+ S+ Sbjct: 423 SDEVWHMRLGHPNQDVLQQLLRNKAIVISKTSHS-LCDACQMGKICKLPFASSD 475