BLASTX nr result
ID: Lithospermum22_contig00043886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043886 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-16 ref|XP_002524945.1| pentatricopeptide repeat-containing protein,... 85 5e-15 emb|CBI33742.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 >ref|XP_003550993.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Glycine max] Length = 628 Score = 89.7 bits (221), Expect = 2e-16 Identities = 46/95 (48%), Positives = 62/95 (65%) Frame = +3 Query: 48 MPSASLVITPPKPSHTPAPEHPTYPPSSYNLSFVIHKAKNITHLNQIHSYLIRRGLETDP 227 M S +L TPP PS T A P NL+ +I +K+ HL QIH+ L+RRGL P Sbjct: 1 MTSTTLFTTPPPPSTTSAA-----PVDKDNLALLIDNSKSTHHLLQIHAALLRRGLHHHP 55 Query: 228 VLNFKLQKAYTSLGNLDYATTLFKQYPNPNVYYYT 332 +LNFKLQ++Y SLG+L ++ TLF + PNPNV+ +T Sbjct: 56 ILNFKLQRSYASLGHLHHSVTLFHRTPNPNVFLWT 90 >ref|XP_002524945.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535780|gb|EEF37442.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 417 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/102 (43%), Positives = 68/102 (66%), Gaps = 6/102 (5%) Frame = +3 Query: 48 MPSASLVITPPK----PSHTPAPEHPT--YPPSSYNLSFVIHKAKNITHLNQIHSYLIRR 209 M SA+ +PP S+T T PPS+ L+ +I K+K+I +L+QIH++L R Sbjct: 1 MSSAAFFPSPPPLLPLQSNTKTSRSITNVQPPSAEKLAIIIDKSKSINNLHQIHAFLYRH 60 Query: 210 GLETDPVLNFKLQKAYTSLGNLDYATTLFKQYPNPNVYYYTT 335 L P+L+FKLQ++Y+SLG+L+++ TLF Q NPNV++YT+ Sbjct: 61 NLHHHPILSFKLQRSYSSLGHLNHSLTLFNQTQNPNVFFYTS 102 >emb|CBI33742.3| unnamed protein product [Vitis vinifera] Length = 562 Score = 84.0 bits (206), Expect = 1e-14 Identities = 43/97 (44%), Positives = 62/97 (63%), Gaps = 2/97 (2%) Frame = +3 Query: 48 MPSASLVITPPKPSHTPAPEHPT--YPPSSYNLSFVIHKAKNITHLNQIHSYLIRRGLET 221 M S +L PP P+ P T + S+ L+ +I K+K I+HL QIH+ L R GL+ Sbjct: 1 MSSTTLFTIPPSPATGSPPTTSTTHHFISTNRLAVLIDKSKTISHLLQIHAVLFRHGLDH 60 Query: 222 DPVLNFKLQKAYTSLGNLDYATTLFKQYPNPNVYYYT 332 P+LNFKLQ++Y SLG LDY+ LF + NP+V+++T Sbjct: 61 HPILNFKLQRSYASLGRLDYSVALFGRTQNPSVFFWT 97 >ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Vitis vinifera] Length = 628 Score = 84.0 bits (206), Expect = 1e-14 Identities = 43/97 (44%), Positives = 62/97 (63%), Gaps = 2/97 (2%) Frame = +3 Query: 48 MPSASLVITPPKPSHTPAPEHPT--YPPSSYNLSFVIHKAKNITHLNQIHSYLIRRGLET 221 M S +L PP P+ P T + S+ L+ +I K+K I+HL QIH+ L R GL+ Sbjct: 1 MSSTTLFTIPPSPATGSPPTTSTTHHFISTNRLAVLIDKSKTISHLLQIHAVLFRHGLDH 60 Query: 222 DPVLNFKLQKAYTSLGNLDYATTLFKQYPNPNVYYYT 332 P+LNFKLQ++Y SLG LDY+ LF + NP+V+++T Sbjct: 61 HPILNFKLQRSYASLGRLDYSVALFGRTQNPSVFFWT 97 >ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] gi|449513125|ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Cucumis sativus] Length = 645 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 4/100 (4%) Frame = +3 Query: 45 SMPSASLVITPPKPSHTPAPEHPTYPPSSYN----LSFVIHKAKNITHLNQIHSYLIRRG 212 S PS + T + S P+ + + +I K+K++ HL QIH+ L+RRG Sbjct: 15 SHPSPPSIFTTNRSSVLPSSSSTARTSDRFQEVERFASLIDKSKSVAHLLQIHASLLRRG 74 Query: 213 LETDPVLNFKLQKAYTSLGNLDYATTLFKQYPNPNVYYYT 332 L +P+LNFKLQ++Y +LG LD + +F + PNV+ ++ Sbjct: 75 LYHNPILNFKLQRSYAALGRLDCSVFVFNTFDEPNVFSFS 114