BLASTX nr result
ID: Lithospermum22_contig00043803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043803 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264630.2| PREDICTED: uncharacterized protein LOC100257... 58 9e-07 emb|CBI18593.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002521414.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002305670.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|AFK46254.1| unknown [Lotus japonicus] 56 3e-06 >ref|XP_002264630.2| PREDICTED: uncharacterized protein LOC100257753 [Vitis vinifera] Length = 508 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 265 IDVRSEIRRQSSNELQIFEDRWEKAAKEDGDWVDPY 158 +D RSEIRRQS+ EL +F DRW+KA KED WVDP+ Sbjct: 457 VDTRSEIRRQSTWELHVFRDRWDKAVKEDRKWVDPF 492 >emb|CBI18593.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 265 IDVRSEIRRQSSNELQIFEDRWEKAAKEDGDWVDPY 158 +D RSEIRRQS+ EL +F DRW+KA KED WVDP+ Sbjct: 191 VDTRSEIRRQSTWELHVFRDRWDKAVKEDRKWVDPF 226 >ref|XP_002521414.1| conserved hypothetical protein [Ricinus communis] gi|223539313|gb|EEF40904.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 265 IDVRSEIRRQSSNELQIFEDRWEKAAKEDGDWVDPY 158 +D R+EIRRQS+ ELQIF++RW +A KED DWVDP+ Sbjct: 307 MDSRTEIRRQSTWELQIFKERWNEAVKEDEDWVDPF 342 >ref|XP_002305670.1| predicted protein [Populus trichocarpa] gi|222848634|gb|EEE86181.1| predicted protein [Populus trichocarpa] Length = 370 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 265 IDVRSEIRRQSSNELQIFEDRWEKAAKEDGDWVDPY 158 +D R EIRRQS+ ELQIF+DRW++A KED +WVDP+ Sbjct: 321 VDPRMEIRRQSTWELQIFKDRWKQAVKEDKNWVDPF 356 >gb|AFK46254.1| unknown [Lotus japonicus] Length = 192 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 265 IDVRSEIRRQSSNELQIFEDRWEKAAKEDGDWVDPY 158 +D R+EIRRQSS ELQIF++RW KA ED +WVDP+ Sbjct: 140 LDARTEIRRQSSWELQIFKERWNKAVAEDRNWVDPF 175