BLASTX nr result
ID: Lithospermum22_contig00043793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043793 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ98258.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 6e-06 >dbj|BAJ98258.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 635 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 123 ADVEPPKARNDNPRTTAAGFDPAPLEKAVQLLQQ 22 A+ PPK RNDNPRTTAAGFDP LE+AV+LL+Q Sbjct: 60 AEEAPPKPRNDNPRTTAAGFDPDALERAVELLRQ 93