BLASTX nr result
ID: Lithospermum22_contig00043730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043730 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867590.1| hypothetical protein ARALYDRAFT_492241 [Arab... 64 1e-08 ref|NP_194309.1| allergen V5/Tpx-1-related family protein [Arabi... 63 2e-08 ref|NP_680450.1| SCP-like extracellular protein domain-containin... 62 5e-08 ref|XP_002864522.1| hypothetical protein ARALYDRAFT_495859 [Arab... 61 1e-07 ref|XP_002452941.1| hypothetical protein SORBIDRAFT_04g035320 [S... 60 2e-07 >ref|XP_002867590.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. lyrata] gi|297313426|gb|EFH43849.1| hypothetical protein ARALYDRAFT_492241 [Arabidopsis lyrata subsp. lyrata] Length = 208 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 124 GSRTEQFMAPQNAIRAKLGLPPLVWDKKLASYARWWAKQRK 2 GS +QF+ P N +R LGLPPLVWD K+ASYA WWA QR+ Sbjct: 70 GSFEQQFLDPHNTVRGNLGLPPLVWDVKIASYATWWANQRR 110 >ref|NP_194309.1| allergen V5/Tpx-1-related family protein [Arabidopsis thaliana] gi|4539297|emb|CAB39600.1| putative pathogenesis-related protein [Arabidopsis thaliana] gi|7269430|emb|CAB79434.1| putative pathogenesis-related protein [Arabidopsis thaliana] gi|38566600|gb|AAR24190.1| At4g25790 [Arabidopsis thaliana] gi|40824065|gb|AAR92336.1| At4g25790 [Arabidopsis thaliana] gi|332659714|gb|AEE85114.1| allergen V5/Tpx-1-related family protein [Arabidopsis thaliana] Length = 210 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 124 GSRTEQFMAPQNAIRAKLGLPPLVWDKKLASYARWWAKQRK 2 GS +QF+ P N +R LGLPPLVWD K+ASYA WWA QR+ Sbjct: 72 GSFEQQFLDPHNTVRGGLGLPPLVWDVKIASYATWWANQRR 112 >ref|NP_680450.1| SCP-like extracellular protein domain-containing protein [Arabidopsis thaliana] gi|9758324|dbj|BAB08798.1| unnamed protein product [Arabidopsis thaliana] gi|28058747|gb|AAO29948.1| Unknown protein [Arabidopsis thaliana] gi|30023648|gb|AAP13357.1| At5g57625 [Arabidopsis thaliana] gi|110742530|dbj|BAE99181.1| pathogenesis-related protein - like [Arabidopsis thaliana] gi|332009544|gb|AED96927.1| SCP-like extracellular protein domain-containing protein [Arabidopsis thaliana] Length = 207 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -2 Query: 124 GSRTEQFMAPQNAIRAKLGLPPLVWDKKLASYARWWAKQRK 2 GS F+ P NA+R+ LGLPPL+WD KLASYA WWA QR+ Sbjct: 69 GSIARLFLDPHNALRSGLGLPPLIWDGKLASYATWWANQRR 109 >ref|XP_002864522.1| hypothetical protein ARALYDRAFT_495859 [Arabidopsis lyrata subsp. lyrata] gi|297310357|gb|EFH40781.1| hypothetical protein ARALYDRAFT_495859 [Arabidopsis lyrata subsp. lyrata] Length = 207 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 124 GSRTEQFMAPQNAIRAKLGLPPLVWDKKLASYARWWAKQRK 2 GS F+ P NA+R++LGL PLVWD KLASYA+WWA QR+ Sbjct: 69 GSIARLFLDPHNALRSRLGLYPLVWDGKLASYAQWWANQRR 109 >ref|XP_002452941.1| hypothetical protein SORBIDRAFT_04g035320 [Sorghum bicolor] gi|241932772|gb|EES05917.1| hypothetical protein SORBIDRAFT_04g035320 [Sorghum bicolor] Length = 181 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -2 Query: 124 GSRTEQFMAPQNAIRAKLGLPPLVWDKKLASYARWWAKQRK 2 G QF+A QNA RA +GLPPL+WD+++ASYARW+A+ R+ Sbjct: 44 GDMRYQFLAQQNAARASMGLPPLIWDERVASYARWYAQSRR 84