BLASTX nr result
ID: Lithospermum22_contig00043655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043655 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY76990.1| hypothetical protein OsI_04946 [Oryza sativa Indi... 59 4e-07 >gb|EAY76990.1| hypothetical protein OsI_04946 [Oryza sativa Indica Group] Length = 156 Score = 58.9 bits (141), Expect = 4e-07 Identities = 21/52 (40%), Positives = 35/52 (67%) Frame = -2 Query: 202 IKCRCGRNAMKWVSFTEKNPGRRFVRCADRVFGCQFWEWIEDPVSPLVCKVM 47 + CRCG A++W+S++ NPGRR+ RC +R GC F++W E S + +++ Sbjct: 34 VMCRCGAKAVRWISWSVDNPGRRYYRCRNRGAGCDFFDWYEPATSSFLRELL 85