BLASTX nr result
ID: Lithospermum22_contig00043509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043509 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444746.1| hypothetical protein SORBIDRAFT_07g027090 [S... 38 6e-06 >ref|XP_002444746.1| hypothetical protein SORBIDRAFT_07g027090 [Sorghum bicolor] gi|241941096|gb|EES14241.1| hypothetical protein SORBIDRAFT_07g027090 [Sorghum bicolor] Length = 881 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 210 RGRKKETLTKWVNA-NCGWCREQGHNVRSCHSKKAGNDPN 94 +GR LTK + +C WC+ HNVR+C KK G P+ Sbjct: 717 QGRNGPKLTKHGSKMHCSWCKSSDHNVRTCELKKEGISPS 756 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 346 SNVLNPLNGMSLWDKDNALPLQPPPHVKLAGRPKKKRNRHITEVKKR 206 +N + P M+ W+K P+ PP + K GRP K R + EV+ R Sbjct: 673 ANNIWPCKDMAAWEKTVGPPVAPPGYEKKVGRPPKARKKQAYEVQGR 719