BLASTX nr result
ID: Lithospermum22_contig00043441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043441 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vitis vinifera] Length = 533 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 456 GRWDNVMELRELMKVRGVSKGTGFSWVGTDAG 361 G+WD+V E+R+LMKVRGVSK TG SWVGTD+G Sbjct: 501 GKWDSVSEVRQLMKVRGVSKDTGCSWVGTDSG 532