BLASTX nr result
ID: Lithospermum22_contig00043381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043381 (186 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] 62 4e-08 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila] 59 3e-07 ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata... 59 3e-07 ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thalia... 59 3e-07 ref|XP_002525819.1| 2-oxoglutarate/malate translocator, chloropl... 59 4e-07 >gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum] Length = 583 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 185 LHELLKVGFIMALVNISIWGVVGTFWWKFLGLY 87 L ++ K+GFIMALVN +IWGVVGTFWWKFLGLY Sbjct: 551 LPDVFKMGFIMALVNATIWGVVGTFWWKFLGLY 583 >dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila] Length = 561 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 185 LHELLKVGFIMALVNISIWGVVGTFWWKFLGLY 87 L ++ K+GF+MA +N IWGVVGTFWWKFLGLY Sbjct: 529 LPDVFKIGFVMATINAVIWGVVGTFWWKFLGLY 561 >ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] gi|297312442|gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata] Length = 561 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 185 LHELLKVGFIMALVNISIWGVVGTFWWKFLGLY 87 L ++ K+GF+MA +N IWGVVGTFWWKFLGLY Sbjct: 529 LPDVFKIGFVMATINAIIWGVVGTFWWKFLGLY 561 >ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana] gi|75171656|sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; Flags: Precursor gi|9759405|dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana] gi|15810581|gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis thaliana] gi|23397031|gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana] gi|53850569|gb|AAU95461.1| At5g64290 [Arabidopsis thaliana] gi|332010483|gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana] Length = 563 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 185 LHELLKVGFIMALVNISIWGVVGTFWWKFLGLY 87 L ++ K+GF+MA +N IWGVVGTFWWKFLGLY Sbjct: 531 LPDVFKIGFVMATINAIIWGVVGTFWWKFLGLY 563 >ref|XP_002525819.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative [Ricinus communis] gi|223534824|gb|EEF36513.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative [Ricinus communis] Length = 337 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -2 Query: 185 LHELLKVGFIMALVNISIWGVVGTFWWKFLGLY 87 L ++ K+GF++AL+N IWGVVGTFWWKFLGLY Sbjct: 305 LPDVFKMGFVIALINAVIWGVVGTFWWKFLGLY 337