BLASTX nr result
ID: Lithospermum22_contig00043358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043358 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589026.1| BEL1-like homeodomain protein [Medicago trun... 104 6e-21 ref|XP_002324760.1| predicted protein [Populus trichocarpa] gi|2... 104 8e-21 ref|XP_003549357.1| PREDICTED: uncharacterized protein LOC100812... 103 1e-20 emb|CBI20629.3| unnamed protein product [Vitis vinifera] 103 1e-20 ref|XP_002308569.1| predicted protein [Populus trichocarpa] gi|2... 103 1e-20 >ref|XP_003589026.1| BEL1-like homeodomain protein [Medicago truncatula] gi|355478074|gb|AES59277.1| BEL1-like homeodomain protein [Medicago truncatula] Length = 524 Score = 104 bits (260), Expect = 6e-21 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 3/74 (4%) Frame = -3 Query: 275 NFLHPYPKDAEKDLLAMKSGLTRGQVSNWFINARVRLWKPLIEEMYAEMSRRNDAGSRNL 96 NFLHPYPKDAEK LLA+KSGLTR QVSNWFINARVRLWKPLIEEMYAEM+RR RN Sbjct: 446 NFLHPYPKDAEKHLLAIKSGLTRSQVSNWFINARVRLWKPLIEEMYAEMNRRK--ACRNE 503 Query: 95 G---TLHHGRYSIN 63 G + R SIN Sbjct: 504 GENESSERSRISIN 517 >ref|XP_002324760.1| predicted protein [Populus trichocarpa] gi|222866194|gb|EEF03325.1| predicted protein [Populus trichocarpa] Length = 323 Score = 104 bits (259), Expect = 8e-21 Identities = 53/71 (74%), Positives = 57/71 (80%) Frame = -3 Query: 275 NFLHPYPKDAEKDLLAMKSGLTRGQVSNWFINARVRLWKPLIEEMYAEMSRRNDAGSRNL 96 NFLHPYPKDAEK LLA KSGLTR QVSNWFINARVRLWKP+IEEMYAEM+RR A Sbjct: 248 NFLHPYPKDAEKHLLAAKSGLTRSQVSNWFINARVRLWKPMIEEMYAEMNRRK-AHQNEE 306 Query: 95 GTLHHGRYSIN 63 GT + R SI+ Sbjct: 307 GTNSNHRISIS 317 >ref|XP_003549357.1| PREDICTED: uncharacterized protein LOC100812648 [Glycine max] Length = 571 Score = 103 bits (258), Expect = 1e-20 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -3 Query: 275 NFLHPYPKDAEKDLLAMKSGLTRGQVSNWFINARVRLWKPLIEEMYAEMSRR 120 NFLHPYPKDAEK LLA+KSGLTR QVSNWFINARVRLWKP+IEEMYAEMSRR Sbjct: 493 NFLHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVRLWKPMIEEMYAEMSRR 544 >emb|CBI20629.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 103 bits (257), Expect = 1e-20 Identities = 51/79 (64%), Positives = 61/79 (77%), Gaps = 9/79 (11%) Frame = -3 Query: 275 NFLHPYPKDAEKDLLAMKSGLTRGQVSNWFINARVRLWKPLIEEMYAEMSRR-------- 120 NFLHPYPKDAEK LLA+KSGLTR QVSNWFINARVRLWKP+IEEMY+EM+RR Sbjct: 265 NFLHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVRLWKPMIEEMYSEMNRRKGRRNDEE 324 Query: 119 -NDAGSRNLGTLHHGRYSI 66 N++ R+ ++ + RY I Sbjct: 325 SNNSNRRSTISMDNQRYKI 343 >ref|XP_002308569.1| predicted protein [Populus trichocarpa] gi|222854545|gb|EEE92092.1| predicted protein [Populus trichocarpa] Length = 209 Score = 103 bits (257), Expect = 1e-20 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -3 Query: 275 NFLHPYPKDAEKDLLAMKSGLTRGQVSNWFINARVRLWKPLIEEMYAEMSRR 120 NFLHPYPKDAEK LLA+KSGLTR QVSNWFINARVRLWKPLIEEMYAEM+RR Sbjct: 157 NFLHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVRLWKPLIEEMYAEMNRR 208