BLASTX nr result
ID: Lithospermum22_contig00043314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043314 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM65612.1| allyl alcohol dehydrogenase, putative [Arabidopsi... 60 2e-09 ref|XP_002893408.1| hypothetical protein ARALYDRAFT_472786 [Arab... 59 3e-09 ref|XP_002331653.1| predicted protein [Populus trichocarpa] gi|2... 57 6e-09 ref|XP_002331649.1| predicted protein [Populus trichocarpa] gi|2... 57 6e-09 ref|XP_002529818.1| alcohol dehydrogenase, putative [Ricinus com... 58 6e-09 >gb|AAM65612.1| allyl alcohol dehydrogenase, putative [Arabidopsis thaliana] Length = 351 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 101 QVDLLKNKFGFEDAFNYKKEDDFAGALKRYFPE 3 +VDLLK KFGF+DAFNYK+E DF+ ALKRYFPE Sbjct: 198 KVDLLKTKFGFDDAFNYKEEKDFSAALKRYFPE 230 Score = 26.9 bits (58), Expect(2) = 2e-09 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 249 YVVGSAGSKDKVSTL 205 YVVGSAGSK+KV L Sbjct: 188 YVVGSAGSKEKVDLL 202 >ref|XP_002893408.1| hypothetical protein ARALYDRAFT_472786 [Arabidopsis lyrata subsp. lyrata] gi|297339250|gb|EFH69667.1| hypothetical protein ARALYDRAFT_472786 [Arabidopsis lyrata subsp. lyrata] Length = 351 Score = 58.9 bits (141), Expect(2) = 3e-09 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 101 QVDLLKNKFGFEDAFNYKKEDDFAGALKRYFPE 3 +VDLLK KFGF+DAFNYK+E DF+ AL+RYFPE Sbjct: 198 KVDLLKTKFGFDDAFNYKEEKDFSAALRRYFPE 230 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 249 YVVGSAGSKDKVSTL 205 YVVGSAGSK+KV L Sbjct: 188 YVVGSAGSKEKVDLL 202 >ref|XP_002331653.1| predicted protein [Populus trichocarpa] gi|222874049|gb|EEF11180.1| predicted protein [Populus trichocarpa] Length = 348 Score = 56.6 bits (135), Expect(2) = 6e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 101 QVDLLKNKFGFEDAFNYKKEDDFAGALKRYFPE 3 +VDLLKNKFGF+DAFNYK+E D ALKRYFP+ Sbjct: 195 KVDLLKNKFGFDDAFNYKEELDLDAALKRYFPD 227 Score = 28.5 bits (62), Expect(2) = 6e-09 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 249 YVVGSAGSKDKVSTL 205 YVVGSAGSKDKV L Sbjct: 185 YVVGSAGSKDKVDLL 199 >ref|XP_002331649.1| predicted protein [Populus trichocarpa] gi|222874045|gb|EEF11176.1| predicted protein [Populus trichocarpa] Length = 348 Score = 56.6 bits (135), Expect(2) = 6e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 101 QVDLLKNKFGFEDAFNYKKEDDFAGALKRYFPE 3 +VDLLKNKFGF+DAFNYK+E D ALKRYFP+ Sbjct: 195 KVDLLKNKFGFDDAFNYKEELDLDAALKRYFPD 227 Score = 28.5 bits (62), Expect(2) = 6e-09 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 249 YVVGSAGSKDKVSTL 205 YVVGSAGSKDKV L Sbjct: 185 YVVGSAGSKDKVDLL 199 >ref|XP_002529818.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530695|gb|EEF32567.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 345 Score = 58.2 bits (139), Expect(2) = 6e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 101 QVDLLKNKFGFEDAFNYKKEDDFAGALKRYFPE 3 +VD+LKNKFGF+DAFNYK+E D ALKRYFPE Sbjct: 192 KVDMLKNKFGFDDAFNYKEEPDLDAALKRYFPE 224 Score = 26.9 bits (58), Expect(2) = 6e-09 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 249 YVVGSAGSKDKVSTL 205 YVVGSAGSK+KV L Sbjct: 182 YVVGSAGSKEKVDML 196