BLASTX nr result
ID: Lithospermum22_contig00043145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043145 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166446.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 106 2e-21 ref|XP_004148253.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 106 2e-21 emb|CBI39751.3| unnamed protein product [Vitis vinifera] 105 4e-21 ref|XP_002522774.1| E3 ubiquitin protein ligase upl2, putative [... 105 4e-21 ref|XP_003524816.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 104 9e-21 >ref|XP_004166446.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL1-like [Cucumis sativus] Length = 3692 Score = 106 bits (264), Expect = 2e-21 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -2 Query: 171 MKFKRKRALEVPPKIRSFIHSVTTAPLESIEEPLRSFTWQFDKGDFHHWVELFNHFD 1 MK KR+RALEVPPKIRSFI++VT+ PLE IEEPL+ F W+FDKGDFHHWV+LFNHFD Sbjct: 1 MKMKRRRALEVPPKIRSFINNVTSVPLEDIEEPLKGFVWEFDKGDFHHWVDLFNHFD 57 >ref|XP_004148253.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Cucumis sativus] Length = 3692 Score = 106 bits (264), Expect = 2e-21 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -2 Query: 171 MKFKRKRALEVPPKIRSFIHSVTTAPLESIEEPLRSFTWQFDKGDFHHWVELFNHFD 1 MK KR+RALEVPPKIRSFI++VT+ PLE IEEPL+ F W+FDKGDFHHWV+LFNHFD Sbjct: 1 MKMKRRRALEVPPKIRSFINNVTSVPLEDIEEPLKGFVWEFDKGDFHHWVDLFNHFD 57 >emb|CBI39751.3| unnamed protein product [Vitis vinifera] Length = 1002 Score = 105 bits (262), Expect = 4e-21 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -2 Query: 171 MKFKRKRALEVPPKIRSFIHSVTTAPLESIEEPLRSFTWQFDKGDFHHWVELFNHFD 1 MK KR+RALEVPPKIRSFI+ VT+ PLE+IEEPL+ F W+FDKGDFHHWV+LFNHFD Sbjct: 1 MKLKRRRALEVPPKIRSFINGVTSTPLENIEEPLKCFIWEFDKGDFHHWVDLFNHFD 57 >ref|XP_002522774.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] gi|223538012|gb|EEF39625.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] Length = 3691 Score = 105 bits (262), Expect = 4e-21 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = -2 Query: 171 MKFKRKRALEVPPKIRSFIHSVTTAPLESIEEPLRSFTWQFDKGDFHHWVELFNHFD 1 MK KR+R+LEVPPKI+SFI+SVT+ PLE+IEEPL+ F W+FDKGDFHHWV+LFNHFD Sbjct: 1 MKLKRRRSLEVPPKIKSFINSVTSTPLENIEEPLKGFVWEFDKGDFHHWVDLFNHFD 57 >ref|XP_003524816.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Glycine max] Length = 3739 Score = 104 bits (259), Expect = 9e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -2 Query: 171 MKFKRKRALEVPPKIRSFIHSVTTAPLESIEEPLRSFTWQFDKGDFHHWVELFNHFD 1 MK KRKRALEVPPKIR FI VT+ PLE IEEPL++F W+FDKGDFHHWV+LFNHFD Sbjct: 1 MKLKRKRALEVPPKIRCFIDRVTSVPLEKIEEPLKAFVWEFDKGDFHHWVDLFNHFD 57