BLASTX nr result
ID: Lithospermum22_contig00043143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043143 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD99221.1| polypepetide with reverse transcriptase and RNas... 61 8e-08 emb|CAN80919.1| hypothetical protein VITISV_002640 [Vitis vinifera] 58 9e-07 ref|XP_003602418.1| Stomatin-like protein [Medicago truncatula] ... 56 3e-06 emb|CAN83015.1| hypothetical protein VITISV_041694 [Vitis vinifera] 55 4e-06 emb|CAN73272.1| hypothetical protein VITISV_013115 [Vitis vinifera] 55 4e-06 >dbj|BAD99221.1| polypepetide with reverse transcriptase and RNaseH domains [Petunia x hybrida] Length = 389 Score = 61.2 bits (147), Expect = 8e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -1 Query: 363 SALHIAKNLVFHERTKCIDMDCHFTREKVLEELLQLAHIPT 241 SA+HIAKN VFHERTK I++DCHF REK+L+ L+ L+ +P+ Sbjct: 313 SAIHIAKNPVFHERTKHIELDCHFVREKLLDGLISLSFVPS 353 >emb|CAN80919.1| hypothetical protein VITISV_002640 [Vitis vinifera] Length = 1450 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -1 Query: 363 SALHIAKNLVFHERTKCIDMDCHFTREKVLEELLQLAHIPT 241 SALH+AKN VFHERTK I++DCHF R+ + + L+ L+++PT Sbjct: 1377 SALHMAKNPVFHERTKHIEVDCHFIRDAITDGLIALSYVPT 1417 >ref|XP_003602418.1| Stomatin-like protein [Medicago truncatula] gi|355491466|gb|AES72669.1| Stomatin-like protein [Medicago truncatula] Length = 605 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 363 SALHIAKNLVFHERTKCIDMDCHFTREKVLEELLQLAHIPT 241 SALHIAKN VFHERTK I++DCHF R ++L LQ +++ T Sbjct: 532 SALHIAKNPVFHERTKHIELDCHFVRNEILHGQLQPSYVST 572 >emb|CAN83015.1| hypothetical protein VITISV_041694 [Vitis vinifera] Length = 1099 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -1 Query: 363 SALHIAKNLVFHERTKCIDMDCHFTREKVLEELLQLAHIPT 241 SALH+AKN VFHERTK I++DCHF R+ + + L+ +++PT Sbjct: 1026 SALHMAKNPVFHERTKHIEVDCHFVRDAITDGLIAPSYVPT 1066 >emb|CAN73272.1| hypothetical protein VITISV_013115 [Vitis vinifera] Length = 1178 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -1 Query: 363 SALHIAKNLVFHERTKCIDMDCHFTREKVLEELLQLAHIPT 241 SALH+AKN VFHERTK I++DCHF R+ + + L+ +++PT Sbjct: 1105 SALHMAKNPVFHERTKHIEVDCHFVRDAITDGLIAPSYVPT 1145