BLASTX nr result
ID: Lithospermum22_contig00043079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043079 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533570.1| Ocs element-binding factor, putative [Ricinu... 59 5e-07 >ref|XP_002533570.1| Ocs element-binding factor, putative [Ricinus communis] gi|223526547|gb|EEF28805.1| Ocs element-binding factor, putative [Ricinus communis] Length = 201 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/63 (44%), Positives = 41/63 (65%) Frame = +3 Query: 3 NRLRLVTHHYQLARSENQQLRSESNILRQRIWELQQVILVRELHHQLPATNLITSSWPGN 182 NRLR V +H+Q R EN QLRSE ++LRQ++ ++Q+++ R+L TS+WP N Sbjct: 135 NRLRFVLYHWQSVRRENDQLRSEHSMLRQKLSNIRQILMFRQLQQ-------FTSAWPCN 187 Query: 183 NNV 191 N V Sbjct: 188 NTV 190