BLASTX nr result
ID: Lithospermum22_contig00043060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043060 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523067.1| ubiquitin-protein ligase, putative [Ricinus ... 81 8e-14 ref|XP_003521565.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-... 80 1e-13 ref|XP_003521564.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-... 80 1e-13 ref|XP_003554523.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-... 79 4e-13 ref|XP_002320347.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 >ref|XP_002523067.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223537629|gb|EEF39252.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 330 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = -2 Query: 154 VCDGTFFPSLLQEMSAVVGFFNKSAQRLLEVHLASGCRKYFLWCRDKVHGS 2 VCDGTFFPSLL EMSA+VG FN+ AQ+LLE+HLASG RKYF+W + K+ G+ Sbjct: 62 VCDGTFFPSLLNEMSAIVGCFNERAQKLLELHLASGVRKYFMWFKGKLKGN 112 >ref|XP_003521565.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like isoform 2 [Glycine max] Length = 322 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -2 Query: 154 VCDGTFFPSLLQEMSAVVGFFNKSAQRLLEVHLASGCRKYFLWCRDKVHGS 2 VCDGTFFPSLL EMS +VG FN+ AQ+LLE+HLASG RKYFLW + K+ G+ Sbjct: 58 VCDGTFFPSLLNEMSDIVGCFNQRAQKLLELHLASGVRKYFLWIKGKLQGN 108 >ref|XP_003521564.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like isoform 1 [Glycine max] Length = 324 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -2 Query: 154 VCDGTFFPSLLQEMSAVVGFFNKSAQRLLEVHLASGCRKYFLWCRDKVHGS 2 VCDGTFFPSLL EMS +VG FN+ AQ+LLE+HLASG RKYFLW + K+ G+ Sbjct: 58 VCDGTFFPSLLNEMSDIVGCFNQRAQKLLELHLASGVRKYFLWIKGKLQGN 108 >ref|XP_003554523.1| PREDICTED: E3 ubiquitin-protein ligase BAH1-like [Glycine max] Length = 324 Score = 79.0 bits (193), Expect = 4e-13 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -2 Query: 154 VCDGTFFPSLLQEMSAVVGFFNKSAQRLLEVHLASGCRKYFLWCRDKVHGS 2 VCDGTFFPSLL EMS +VG FN+ AQ+LLE+HLASG RKYF W + K+ G+ Sbjct: 58 VCDGTFFPSLLNEMSDIVGCFNQRAQKLLELHLASGVRKYFFWIKGKLQGN 108 >ref|XP_002320347.1| predicted protein [Populus trichocarpa] gi|222861120|gb|EEE98662.1| predicted protein [Populus trichocarpa] Length = 320 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -2 Query: 154 VCDGTFFPSLLQEMSAVVGFFNKSAQRLLEVHLASGCRKYFLWCRDKV 11 VCDGTFFPSL++EMSAVVG FNK AQ+LLE+HLASG RKYF+W + ++ Sbjct: 54 VCDGTFFPSLVKEMSAVVGCFNKRAQKLLELHLASGFRKYFMWFQGRL 101