BLASTX nr result
ID: Lithospermum22_contig00043005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00043005 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. ru... 57 2e-06 >dbj|BAK64102.1| gag-pol polyprotein [Eustoma exaltatum subsp. russellianum] Length = 1591 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/36 (55%), Positives = 28/36 (77%) Frame = -3 Query: 283 KVDKSHLKCDHCGKRGHLKVNYFKIKGYPEWWPGNK 176 ++DKS+L C+HCGK+GH + F+I GYPEWW G + Sbjct: 294 RMDKSNLLCEHCGKKGHSREKCFQIHGYPEWWEGKR 329