BLASTX nr result
ID: Lithospermum22_contig00042918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042918 (578 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535828.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_002517741.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis] gi|255608154|ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis] gi|223510119|gb|EEF23533.1| conserved hypothetical protein [Ricinus communis] gi|223521805|gb|EEF26555.1| conserved hypothetical protein [Ricinus communis] Length = 86 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/51 (72%), Positives = 40/51 (78%), Gaps = 4/51 (7%) Frame = +2 Query: 47 NGRGGSTRSVKFRRKTVGSRWR--LAP-SKGNAGR-LELGRGFENRVGSCP 187 +G GGSTRSVKFRRKTVGSRWR P K GR ++LGRGFENRVGSCP Sbjct: 36 DGGGGSTRSVKFRRKTVGSRWRPFFGPLQKEMRGRGVKLGRGFENRVGSCP 86 >ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis] gi|223543139|gb|EEF44673.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/49 (69%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = +3 Query: 39 LKQTGGEDRPVQSNSEERLLAAGGDWPL----QKEMRAG*SSAEGSRIG 173 LKQ G EDRPVQSN EERLLA GGD L +K AG SSAEGSRIG Sbjct: 63 LKQKGEEDRPVQSNFEERLLAVGGDLSLALFKRKCRGAGLSSAEGSRIG 111