BLASTX nr result
ID: Lithospermum22_contig00042754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042754 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150006.1| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 116 2e-24 ref|XP_003629401.1| Abscisic acid 8'-hydroxylase [Medicago trunc... 106 2e-21 ref|XP_003548874.1| PREDICTED: cytochrome P450 716B1-like [Glyci... 105 5e-21 ref|XP_002521537.1| cytochrome P450, putative [Ricinus communis]... 103 1e-20 ref|XP_002269279.2| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 102 4e-20 >ref|XP_004150006.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] gi|449520849|ref|XP_004167445.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Cucumis sativus] Length = 472 Score = 116 bits (290), Expect = 2e-24 Identities = 57/82 (69%), Positives = 70/82 (85%), Gaps = 1/82 (1%) Frame = -1 Query: 245 DKMVQERLMKHE-DGKSFVLLEFNMKATFDAMCDMLMSIRDPSLLQQFERHCTAISDAML 69 D M+ +RL K E DGKSFVLL+F+MK TFD++C+MLMS+RD S L+Q E+ CTA+S+AML Sbjct: 152 DDMLSKRLKKLEKDGKSFVLLDFSMKITFDSICNMLMSLRDESTLRQIEKDCTAVSEAML 211 Query: 68 SFPVMIPGTRYYKGIKAREMLM 3 SFP MIPGTRYYKGIKAR+ LM Sbjct: 212 SFPFMIPGTRYYKGIKARKRLM 233 >ref|XP_003629401.1| Abscisic acid 8'-hydroxylase [Medicago truncatula] gi|355523423|gb|AET03877.1| Abscisic acid 8'-hydroxylase [Medicago truncatula] Length = 519 Score = 106 bits (265), Expect = 2e-21 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%) Frame = -1 Query: 245 DKMVQERLMK-HEDGKSFVLLEFNMKATFDAMCDMLMSIRDPSLLQQFERHCTAISDAML 69 DK++ RL K E GKSF L+F M+ TFDAMC MLMSI + SLL+Q E+ CTA+S+AML Sbjct: 165 DKLLCGRLQKLEESGKSFKTLDFCMEMTFDAMCGMLMSITEDSLLRQIEKDCTAVSNAML 224 Query: 68 SFPVMIPGTRYYKGIKAREMLM 3 SFPVMIPGTRYYKGI AR LM Sbjct: 225 SFPVMIPGTRYYKGITARNRLM 246 >ref|XP_003548874.1| PREDICTED: cytochrome P450 716B1-like [Glycine max] Length = 494 Score = 105 bits (261), Expect = 5e-21 Identities = 54/82 (65%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = -1 Query: 245 DKMVQERLMK-HEDGKSFVLLEFNMKATFDAMCDMLMSIRDPSLLQQFERHCTAISDAML 69 DKM+ RL K E GKSF +L+ MK TFDAMCDMLMSI + SLL+Q E CTA+SDAML Sbjct: 167 DKMLCGRLQKLEESGKSFKVLDLCMKMTFDAMCDMLMSITEDSLLRQIEEDCTAVSDAML 226 Query: 68 SFPVMIPGTRYYKGIKAREMLM 3 S P+MIP TRYYKGI AR+ +M Sbjct: 227 SIPIMIPRTRYYKGITARKRVM 248 >ref|XP_002521537.1| cytochrome P450, putative [Ricinus communis] gi|223539215|gb|EEF40808.1| cytochrome P450, putative [Ricinus communis] Length = 492 Score = 103 bits (258), Expect = 1e-20 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 1/82 (1%) Frame = -1 Query: 245 DKMVQERLMK-HEDGKSFVLLEFNMKATFDAMCDMLMSIRDPSLLQQFERHCTAISDAML 69 D+M+ L K E GK F +L+F+MK TFDAMC+MLMS+ + SLL+ E+ CTAISD+ML Sbjct: 170 DQMLAWELKKLEESGKCFTVLDFSMKMTFDAMCNMLMSVTEDSLLRGIEKDCTAISDSML 229 Query: 68 SFPVMIPGTRYYKGIKAREMLM 3 S P+MIPGTRYY+GIKAR+ LM Sbjct: 230 SIPLMIPGTRYYQGIKARQRLM 251 >ref|XP_002269279.2| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Vitis vinifera] Length = 471 Score = 102 bits (253), Expect = 4e-20 Identities = 50/82 (60%), Positives = 65/82 (79%), Gaps = 1/82 (1%) Frame = -1 Query: 245 DKMVQERLMKHEDG-KSFVLLEFNMKATFDAMCDMLMSIRDPSLLQQFERHCTAISDAML 69 D M+ +RL K E+G KSFV+ +F MK FDA+C+ L+S+ + LLQ+ ER CT +S+AML Sbjct: 145 DNMLYQRLNKLEEGGKSFVVFDFCMKIAFDAICNRLISVTEAPLLQEIERDCTYVSNAML 204 Query: 68 SFPVMIPGTRYYKGIKAREMLM 3 SFP+MIPGTRYYKGIKAR+ LM Sbjct: 205 SFPLMIPGTRYYKGIKARKRLM 226