BLASTX nr result
ID: Lithospermum22_contig00042719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042719 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [G... 60 1e-07 >gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 224 NWSSSGTGPSIDHRAYSTLTEFILLKRNVK 135 +WSSSGTGPSIDH AYSTLTEFILLKRNVK Sbjct: 100 DWSSSGTGPSIDHGAYSTLTEFILLKRNVK 129