BLASTX nr result
ID: Lithospermum22_contig00042399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042399 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588566.1| HAT family dimerization domain containing pr... 89 5e-16 ref|XP_003619807.1| Zinc finger MYM-type protein [Medicago trunc... 87 1e-15 ref|XP_003619431.1| HAT family dimerization domain containing pr... 87 1e-15 ref|XP_003601457.1| HAT family dimerization domain containing pr... 87 1e-15 ref|XP_003599278.1| HAT family dimerization domain containing pr... 87 1e-15 >ref|XP_003588566.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355477614|gb|AES58817.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 786 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/82 (51%), Positives = 58/82 (70%) Frame = +3 Query: 3 MKTFRFVFMLHLMVDVLSVTNDLSEAL*RGDQDIVNAMELVEINKKTFQKMREDGWEGFY 182 +++F F+FML++MV++L +TNDLS AL R DQD++NA+ LV KK Q+MR +GWE Sbjct: 505 LQSFDFIFMLYMMVEILGITNDLSLALQRRDQDLLNAISLVNDTKKQLQEMRNEGWEDLI 564 Query: 183 EKVVSSCGNLEITVRDMDVRYV 248 KVV+ C EI V DMD Y+ Sbjct: 565 SKVVTICTKHEIDVPDMDAPYM 586 >ref|XP_003619807.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355494822|gb|AES76025.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 752 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/82 (50%), Positives = 58/82 (70%) Frame = +3 Query: 3 MKTFRFVFMLHLMVDVLSVTNDLSEAL*RGDQDIVNAMELVEINKKTFQKMREDGWEGFY 182 +++F F+FML++MV++L +TNDLS AL R DQD++NA+ LV KK Q+MR +GWE Sbjct: 447 LQSFDFIFMLYMMVEILGITNDLSLALQRRDQDLLNAISLVNDTKKQLQEMRNEGWEDLI 506 Query: 183 EKVVSSCGNLEITVRDMDVRYV 248 +VV+ C EI V DMD Y+ Sbjct: 507 SRVVTICTKHEIDVPDMDAPYM 528 >ref|XP_003619431.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355494446|gb|AES75649.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 969 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/82 (50%), Positives = 58/82 (70%) Frame = +3 Query: 3 MKTFRFVFMLHLMVDVLSVTNDLSEAL*RGDQDIVNAMELVEINKKTFQKMREDGWEGFY 182 +++F F+FML++MV++L +TNDLS AL R DQD++NA+ LV KK Q+MR +GWE Sbjct: 505 LQSFDFIFMLYMMVEILGITNDLSLALQRRDQDLLNAISLVNDTKKQLQEMRNEGWEELI 564 Query: 183 EKVVSSCGNLEITVRDMDVRYV 248 +VV+ C EI V DMD Y+ Sbjct: 565 SRVVTICTKHEIDVPDMDAPYM 586 >ref|XP_003601457.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355490505|gb|AES71708.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 790 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/82 (50%), Positives = 58/82 (70%) Frame = +3 Query: 3 MKTFRFVFMLHLMVDVLSVTNDLSEAL*RGDQDIVNAMELVEINKKTFQKMREDGWEGFY 182 +++F F+FML++MV++L +TNDLS AL R DQD++NA+ LV KK Q+MR +GWE Sbjct: 505 LQSFDFIFMLYMMVEILGITNDLSLALQRRDQDLLNAISLVNDTKKQLQEMRNEGWEELI 564 Query: 183 EKVVSSCGNLEITVRDMDVRYV 248 +VV+ C EI V DMD Y+ Sbjct: 565 SRVVTICTKHEIDVPDMDAPYM 586 >ref|XP_003599278.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355488326|gb|AES69529.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 877 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/82 (50%), Positives = 58/82 (70%) Frame = +3 Query: 3 MKTFRFVFMLHLMVDVLSVTNDLSEAL*RGDQDIVNAMELVEINKKTFQKMREDGWEGFY 182 +++F F+FML++MV++L +TNDLS AL R DQD++NA+ LV KK Q+MR +GWE Sbjct: 592 LQSFDFIFMLYMMVEILGITNDLSLALQRRDQDLLNAISLVNDTKKQLQEMRNEGWEELI 651 Query: 183 EKVVSSCGNLEITVRDMDVRYV 248 +VV+ C EI V DMD Y+ Sbjct: 652 SRVVTICTKHEIDVPDMDAPYM 673