BLASTX nr result
ID: Lithospermum22_contig00042234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042234 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus c... 87 1e-15 ref|XP_002320185.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 emb|CBI34458.3| unnamed protein product [Vitis vinifera] 85 7e-15 ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243... 85 7e-15 ref|XP_004168407.1| PREDICTED: uncharacterized LOC101208193 [Cuc... 79 4e-13 >ref|XP_002533909.1| hypothetical protein RCOM_0237030 [Ricinus communis] gi|223526130|gb|EEF28474.1| hypothetical protein RCOM_0237030 [Ricinus communis] Length = 916 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = +2 Query: 101 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGCGAVLRASKMNGDLETFSEKCDEKSIGG 280 M++ KVRLVRCPKC NLL EL DYS+Y+CGGCGAVLRA N D +T S K DE + G Sbjct: 1 MTDSTKVRLVRCPKCENLLPELADYSVYQCGGCGAVLRAKDKNPDTDTVSHKSDEAQLVG 60 Query: 281 VSEKL 295 V+ +L Sbjct: 61 VATEL 65 >ref|XP_002320185.1| predicted protein [Populus trichocarpa] gi|222860958|gb|EEE98500.1| predicted protein [Populus trichocarpa] Length = 778 Score = 85.5 bits (210), Expect = 4e-15 Identities = 41/63 (65%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = +2 Query: 101 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGCGAVLRASKMNGDLETFS-EKCDEKSIG 277 M+E KVRLVRCPKC NLL EL DYS+Y+CGGCGAVLRA N D +T S EK DE + Sbjct: 1 MAESTKVRLVRCPKCENLLPELADYSVYQCGGCGAVLRAKNKNRDTDTLSLEKSDEVRVA 60 Query: 278 GVS 286 GV+ Sbjct: 61 GVA 63 >emb|CBI34458.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +2 Query: 101 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGCGAVLRASKMNGDLETFSEKCDEKSIGG 280 M+E +KVR+VRCPKC NLL EL DY +Y+CGGCGAVLRA K + SEK D+++ G Sbjct: 1 MAEGSKVRVVRCPKCENLLPELPDYPVYQCGGCGAVLRAKKKAPSNDALSEKSDDENGRG 60 Query: 281 VSEKL 295 VSEKL Sbjct: 61 VSEKL 65 >ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243335 [Vitis vinifera] Length = 956 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +2 Query: 101 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGCGAVLRASKMNGDLETFSEKCDEKSIGG 280 M+E +KVR+VRCPKC NLL EL DY +Y+CGGCGAVLRA K + SEK D+++ G Sbjct: 1 MAEGSKVRVVRCPKCENLLPELPDYPVYQCGGCGAVLRAKKKAPSNDALSEKSDDENGRG 60 Query: 281 VSEKL 295 VSEKL Sbjct: 61 VSEKL 65 >ref|XP_004168407.1| PREDICTED: uncharacterized LOC101208193 [Cucumis sativus] Length = 878 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/62 (59%), Positives = 44/62 (70%) Frame = +2 Query: 101 MSEVAKVRLVRCPKCHNLLQELNDYSIYECGGCGAVLRASKMNGDLETFSEKCDEKSIGG 280 MS AK+RLVRCPKC NLL EL DYS+Y+CGGCG VLRA N + ++ S K DE + G Sbjct: 1 MSASAKLRLVRCPKCENLLPELADYSVYQCGGCGTVLRAKVRNKEEDSLSYKSDEDGVVG 60 Query: 281 VS 286 S Sbjct: 61 SS 62