BLASTX nr result
ID: Lithospermum22_contig00042196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042196 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcr... 62 6e-08 ref|XP_004149975.1| PREDICTED: uncharacterized protein LOC101222... 60 1e-07 gb|AAD32866.1|AC005489_4 F14N23.4 [Arabidopsis thaliana] 57 1e-06 gb|AAD26953.1| putative non-LTR retrolelement reverse transcript... 57 2e-06 ref|NP_567266.1| RNA-directed DNA polymerase (reverse transcript... 55 6e-06 >ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|98962153|gb|ABF59406.1| unknown protein [Arabidopsis thaliana] gi|332004916|gb|AED92299.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 209 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 421 VEEKVIWSK*LWFKGCVPRHSFCCWVLCHKKLPTRDRLLKWGMQV 287 V EKV W K +WFKG +P+H+F WV +LPTRD+LL WG+ V Sbjct: 138 VGEKVDWHKAIWFKGRIPKHAFISWVNIRHRLPTRDKLLSWGLHV 182 >ref|XP_004149975.1| PREDICTED: uncharacterized protein LOC101222747 [Cucumis sativus] Length = 163 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 9/82 (10%) Frame = -1 Query: 412 KVIWSK*LWFKGCVPRHSFCCWVLCHKKLPTRDRLLKWGMQVAVSK-YGGKSFRSRLYKL 236 +V WS LW G +P+HSFC W+ +L TRDRL +W + +S+ G ++ SR ++ Sbjct: 45 RVGWSDLLWGGGNIPKHSFCAWLAIKDRLGTRDRLSRWDRSIPLSRLLCGGNYESRYWEE 104 Query: 235 C--------LNCVVYEVWNERN 194 C + +Y +W ERN Sbjct: 105 CEEKTVAPLSSATIYFIWQERN 126 >gb|AAD32866.1|AC005489_4 F14N23.4 [Arabidopsis thaliana] Length = 1161 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = -1 Query: 409 VIWSK*LWFKGCVPRHSFCCWVLCHKKLPTRDRLLKWGMQV 287 V+W K +WFK VP+ +F CWV+ H +L TRDRL +WG + Sbjct: 984 VLWHKAVWFKDHVPKQAFICWVVAHNRLHTRDRLRRWGFSI 1024 >gb|AAD26953.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 323 Score = 56.6 bits (135), Expect = 2e-06 Identities = 21/41 (51%), Positives = 29/41 (70%) Frame = -1 Query: 409 VIWSK*LWFKGCVPRHSFCCWVLCHKKLPTRDRLLKWGMQV 287 V W K +WFK +P+H+F CWV K+L TRDRL +WG+ + Sbjct: 152 VPWQKSVWFKDRIPKHAFICWVAAWKRLHTRDRLTQWGLNI 192 >ref|NP_567266.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|5732057|gb|AAD48956.1|AF149414_5 contains similarity to a family of Arabidopsis thaliana predicted proteins, which have similarity to reverse transcriptases; see T14P8.10 (GB:AF069298) [Arabidopsis thaliana] gi|7267223|emb|CAB80830.1| AT4g04650 [Arabidopsis thaliana] gi|332657009|gb|AEE82409.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 332 Score = 55.1 bits (131), Expect = 6e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = -1 Query: 409 VIWSK*LWFKGCVPRHSFCCWVLCHKKLPTRDRLLKWGMQV 287 V W K +WFK VP+H+F CWV+ +L TRDRL WG+ + Sbjct: 127 VPWHKAVWFKNHVPKHAFICWVVAWNRLHTRDRLQNWGLSI 167