BLASTX nr result
ID: Lithospermum22_contig00042147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042147 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514129.1| calmodulin binding protein, putative [Ricinu... 83 2e-14 ref|XP_002309213.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 ref|XP_003549227.1| PREDICTED: uncharacterized protein LOC100776... 80 2e-13 ref|XP_002279373.1| PREDICTED: uncharacterized protein LOC100256... 79 4e-13 emb|CAN80416.1| hypothetical protein VITISV_024541 [Vitis vinifera] 79 4e-13 >ref|XP_002514129.1| calmodulin binding protein, putative [Ricinus communis] gi|223546585|gb|EEF48083.1| calmodulin binding protein, putative [Ricinus communis] Length = 541 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -2 Query: 437 RALEQVNLSPRLPNGATSSYGPIPSPRPSPRVHLSPRIAYMGLLSPRTPI 288 RALEQVNLSPR+P G+ S+YGPIPSPRPSP+V +SPR+AYMGL SPRT + Sbjct: 489 RALEQVNLSPRVPPGSLSNYGPIPSPRPSPQVRVSPRLAYMGLPSPRTRV 538 >ref|XP_002309213.1| predicted protein [Populus trichocarpa] gi|222855189|gb|EEE92736.1| predicted protein [Populus trichocarpa] Length = 536 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = -2 Query: 437 RALEQVNLSPRLPNGATSSYGPIPSPRPSPRVHLSPRIAYMGLLSPRTPI 288 RALEQVNLSPR+ G ++YGP+PSPRPSP+V +SPR+AYMG+ SPRTPI Sbjct: 483 RALEQVNLSPRVAPGHLANYGPVPSPRPSPKVRVSPRLAYMGIPSPRTPI 532 >ref|XP_003549227.1| PREDICTED: uncharacterized protein LOC100776993 [Glycine max] Length = 530 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/50 (76%), Positives = 42/50 (84%) Frame = -2 Query: 437 RALEQVNLSPRLPNGATSSYGPIPSPRPSPRVHLSPRIAYMGLLSPRTPI 288 RALEQVNLSPR + S+YGPIPSPRPSP+V +SPRIAYMGL SPR PI Sbjct: 477 RALEQVNLSPRPTSARLSNYGPIPSPRPSPKVRMSPRIAYMGLPSPRNPI 526 >ref|XP_002279373.1| PREDICTED: uncharacterized protein LOC100256072 [Vitis vinifera] gi|297738645|emb|CBI27890.3| unnamed protein product [Vitis vinifera] Length = 535 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -2 Query: 437 RALEQVNLSPRLPNGATSSYGPIPSPRPSPRVHLSPRIAYMGLLSPRTPI 288 RALEQVNLSPR+ G + GPIPSPRPSP++ LSPR+AYMGL SPRTPI Sbjct: 482 RALEQVNLSPRVTPGPFGNCGPIPSPRPSPKIRLSPRLAYMGLPSPRTPI 531 >emb|CAN80416.1| hypothetical protein VITISV_024541 [Vitis vinifera] Length = 544 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = -2 Query: 437 RALEQVNLSPRLPNGATSSYGPIPSPRPSPRVHLSPRIAYMGLLSPRTPI 288 RALEQVNLSPR+ G + GPIPSPRPSP++ LSPR+AYMGL SPRTPI Sbjct: 491 RALEQVNLSPRVTPGPFGNCGPIPSPRPSPKIRLSPRLAYMGLPSPRTPI 540