BLASTX nr result
ID: Lithospermum22_contig00042100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042100 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62943.1| hypothetical protein VITISV_002228 [Vitis vinifera] 56 3e-06 >emb|CAN62943.1| hypothetical protein VITISV_002228 [Vitis vinifera] Length = 324 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/43 (53%), Positives = 36/43 (83%) Frame = -2 Query: 216 ENIINIKKFLIQYCQERQREGYQMLKDPLHLFYDALVVGLNFD 88 ++I +K+FL QYC+ER++ G+ MLKDPL LFY+A+ VGL+++ Sbjct: 183 KSIEGVKQFLQQYCKERRQAGFAMLKDPLSLFYEAICVGLDYE 225