BLASTX nr result
ID: Lithospermum22_contig00042097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042097 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-... 80 1e-13 gb|AFN53653.1| putative G-patch domain protein [Linum usitatissi... 80 2e-13 ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-... 76 3e-12 ref|XP_002532335.1| conserved hypothetical protein [Ricinus comm... 76 3e-12 ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-... 74 1e-11 >ref|XP_003520533.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max] Length = 565 Score = 80.5 bits (197), Expect = 1e-13 Identities = 40/63 (63%), Positives = 51/63 (80%), Gaps = 2/63 (3%) Frame = +1 Query: 43 FEYGLLPIPKLIFSDPTQTLTQIKHKLLSLS--PKADVAAISDALQIPTHHARLVIETID 216 FE+GLLPIP+LIFSDPTQTL +K KLL LS + D AAIS++LQIP HARLV++T+ Sbjct: 28 FEHGLLPIPRLIFSDPTQTLISLKQKLLELSSNQRVDSAAISESLQIPIEHARLVLDTLA 87 Query: 217 SVI 225 S++ Sbjct: 88 SIL 90 >gb|AFN53653.1| putative G-patch domain protein [Linum usitatissimum] Length = 565 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = +1 Query: 43 FEYGLLPIPKLIFSDPTQTLTQIKHKLLSLSPKADVAAISDALQIPTHHARLVIETIDSV 222 FE+GLLPIPKLIF+DPTQTL Q++ K LS P+ D A++DALQI T HARLV++T+ SV Sbjct: 39 FEHGLLPIPKLIFTDPTQTLGQLRQK-LSSQPRVDATALADALQISTDHARLVLDTLASV 97 Query: 223 I 225 + Sbjct: 98 L 98 >ref|XP_003554199.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max] Length = 565 Score = 76.3 bits (186), Expect = 3e-12 Identities = 38/63 (60%), Positives = 50/63 (79%), Gaps = 2/63 (3%) Frame = +1 Query: 43 FEYGLLPIPKLIFSDPTQTLTQIKHKLLSLS--PKADVAAISDALQIPTHHARLVIETID 216 FE+GLLPIP+LIFSDP QTL +K KLL LS + D+AAIS++LQI HARLV++T+ Sbjct: 28 FEHGLLPIPRLIFSDPAQTLIPLKQKLLELSSNQRVDLAAISESLQISIEHARLVLDTLA 87 Query: 217 SVI 225 S++ Sbjct: 88 SIL 90 >ref|XP_002532335.1| conserved hypothetical protein [Ricinus communis] gi|223527952|gb|EEF30037.1| conserved hypothetical protein [Ricinus communis] Length = 572 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/61 (57%), Positives = 49/61 (80%) Frame = +1 Query: 43 FEYGLLPIPKLIFSDPTQTLTQIKHKLLSLSPKADVAAISDALQIPTHHARLVIETIDSV 222 FE+GLLPIPKLIF DPTQ L+Q+K KL S + + D A ++++LQI T HARLV++T+ S+ Sbjct: 37 FEHGLLPIPKLIFPDPTQALSQLKQKLASHNGRIDTAILAESLQISTDHARLVLDTLASI 96 Query: 223 I 225 + Sbjct: 97 L 97 >ref|XP_003554198.1| PREDICTED: TBCC domain-containing protein 1-like [Glycine max] Length = 566 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = +1 Query: 43 FEYGLLPIPKLIFSDPTQTLTQIKHKLLSLS--PKADVAAISDALQIPTHHARLVIETID 216 FE+GLLPIP+ IFSDP QTL +K KLL LS + D AAIS++LQI HARLV++T+ Sbjct: 28 FEHGLLPIPRFIFSDPAQTLIPLKQKLLELSSNQRVDSAAISESLQISIEHARLVLDTLA 87 Query: 217 SVI 225 SV+ Sbjct: 88 SVL 90