BLASTX nr result
ID: Lithospermum22_contig00042075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00042075 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis t... 91 8e-17 gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsi... 91 8e-17 emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera] 89 5e-16 dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x ... 88 6e-16 gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 88 8e-16 >dbj|BAA97287.1| retroelement pol polyprotein-like [Arabidopsis thaliana] Length = 1491 Score = 91.3 bits (225), Expect = 8e-17 Identities = 45/76 (59%), Positives = 56/76 (73%), Gaps = 3/76 (3%) Frame = -2 Query: 222 NHTDFQYFTN---TQGIVHYKTCVFKPQQDGVVERKHQHLLQVPRALMIQSFLQVKFWGD 52 N T+F ++ QGIVH +CV PQQ+G VERKH+H+L V RAL+ Q+ L +KFWG+ Sbjct: 637 NGTEFMCLSSYFKEQGIVHQTSCVGTPQQNGRVERKHRHILNVSRALLFQASLPIKFWGE 696 Query: 51 AVMAATYLINRTPSSI 4 AVM A YLINRTPSSI Sbjct: 697 AVMTAAYLINRTPSSI 712 >gb|AAC67205.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1413 Score = 91.3 bits (225), Expect = 8e-17 Identities = 45/76 (59%), Positives = 56/76 (73%), Gaps = 3/76 (3%) Frame = -2 Query: 222 NHTDFQYFTN---TQGIVHYKTCVFKPQQDGVVERKHQHLLQVPRALMIQSFLQVKFWGD 52 N T+F ++ QGIVH +CV PQQ+G VERKH+H+L V RAL+ Q+ L +KFWG+ Sbjct: 637 NGTEFMCLSSYFKEQGIVHQTSCVGTPQQNGRVERKHRHILNVSRALLFQASLPIKFWGE 696 Query: 51 AVMAATYLINRTPSSI 4 AVM A YLINRTPSSI Sbjct: 697 AVMTAAYLINRTPSSI 712 >emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera] Length = 1523 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/76 (53%), Positives = 57/76 (75%), Gaps = 2/76 (2%) Frame = -2 Query: 222 NHTDFQY--FTNTQGIVHYKTCVFKPQQDGVVERKHQHLLQVPRALMIQSFLQVKFWGDA 49 N +F++ F +++GI+H +C+ PQQ+GVVERKH+HLL V RAL+ QS L FWGDA Sbjct: 655 NGPEFKHTQFYSSRGILHQTSCINTPQQNGVVERKHRHLLNVARALLFQSHLPKPFWGDA 714 Query: 48 VMAATYLINRTPSSIL 1 ++ A YLINRTP+ +L Sbjct: 715 ILTAAYLINRTPTPLL 730 >dbj|BAD99220.1| polypeptide with an integrase domain [Petunia x hybrida] Length = 492 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/67 (61%), Positives = 50/67 (74%) Frame = -2 Query: 201 FTNTQGIVHYKTCVFKPQQDGVVERKHQHLLQVPRALMIQSFLQVKFWGDAVMAATYLIN 22 F + GI+H TCV PQQ+GVVERKH+HLL+ RAL+ QS L KFWGD ++ ATYLIN Sbjct: 153 FLASLGIIHQTTCVGTPQQNGVVERKHRHLLETCRALLYQSHLPKKFWGDCLLTATYLIN 212 Query: 21 RTPSSIL 1 R PS +L Sbjct: 213 RFPSKVL 219 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/77 (53%), Positives = 56/77 (72%), Gaps = 3/77 (3%) Frame = -2 Query: 222 NHTDFQYFTN---TQGIVHYKTCVFKPQQDGVVERKHQHLLQVPRALMIQSFLQVKFWGD 52 N T+F ++ GI+H +CV PQQ+G VERKH+H+L V RAL+ Q+ L +KFWG+ Sbjct: 654 NGTEFMCLSSYFRENGIIHQTSCVGTPQQNGRVERKHRHILNVARALLFQASLPIKFWGE 713 Query: 51 AVMAATYLINRTPSSIL 1 +++ A YLINRTPSSIL Sbjct: 714 SILTAAYLINRTPSSIL 730