BLASTX nr result
ID: Lithospermum22_contig00041958
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041958 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002459653.1| hypothetical protein SORBIDRAFT_02g008045 [S... 60 1e-07 ref|XP_002512190.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002450843.1| hypothetical protein SORBIDRAFT_05g019526 [S... 56 4e-06 ref|XP_002447968.1| hypothetical protein SORBIDRAFT_06g019043 [S... 55 8e-06 >ref|XP_002459653.1| hypothetical protein SORBIDRAFT_02g008045 [Sorghum bicolor] gi|241923030|gb|EER96174.1| hypothetical protein SORBIDRAFT_02g008045 [Sorghum bicolor] Length = 723 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 1/78 (1%) Frame = -3 Query: 255 VEVKSFSTHHMEALIWEGEGDPWRFIGFDGNHEAGNHKHSWNLMTLVNGLSKFPTVVMGD 76 +E+ +S +H++A+I EG+ +PWR G + +W+L+ + S P +GD Sbjct: 379 LEILPYSQYHIDAIIKEGDNEPWRLTCVYGEAQVSERHKTWSLLKFIKASSPLPWACVGD 438 Query: 75 FNEVLNANEHF-FQRRQR 25 FNEVL+ +EH Q R R Sbjct: 439 FNEVLHQSEHVGVQERSR 456 >ref|XP_002512190.1| conserved hypothetical protein [Ricinus communis] gi|223548734|gb|EEF50224.1| conserved hypothetical protein [Ricinus communis] Length = 216 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -3 Query: 255 VEVKSFSTHHMEALIWEGEGDPWRFIGFDGNHEAGNHKHSWNLMTLVNGLSKF---PTVV 85 V VKSFS H++AL+ E D W F GF GN + SW+L+ + +++F P ++ Sbjct: 77 VSVKSFSPGHIDALVCFDESDVWHFTGFYGNLNSFLRHFSWDLIRRLGSMAEFSNLPWLM 136 Query: 84 MGDFNEVLNANE 49 GDFNE+L +E Sbjct: 137 GGDFNEILMQSE 148 >ref|XP_002450843.1| hypothetical protein SORBIDRAFT_05g019526 [Sorghum bicolor] gi|241936686|gb|EES09831.1| hypothetical protein SORBIDRAFT_05g019526 [Sorghum bicolor] Length = 1209 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/70 (34%), Positives = 40/70 (57%) Frame = -3 Query: 255 VEVKSFSTHHMEALIWEGEGDPWRFIGFDGNHEAGNHKHSWNLMTLVNGLSKFPTVVMGD 76 V++ +S +H++ +I EG DPWR G + +W+++ + S P V +GD Sbjct: 342 VQLLPYSKYHIDVIISEGSADPWRLTCVYGEAQIVERYKTWDMLKSIKPNSSLPWVCIGD 401 Query: 75 FNEVLNANEH 46 FNEVL+ +EH Sbjct: 402 FNEVLHRSEH 411 >ref|XP_002447968.1| hypothetical protein SORBIDRAFT_06g019043 [Sorghum bicolor] gi|241939151|gb|EES12296.1| hypothetical protein SORBIDRAFT_06g019043 [Sorghum bicolor] Length = 678 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = -3 Query: 255 VEVKSFSTHHMEALIWE--GEGDPWRFIGFDGNHEAGNHKHSWNLMTLVNGLSKFPTVVM 82 V+++++ H++ ++ + D WRF GF G N SW LM ++ S P + Sbjct: 332 VKLQTYDKLHIDVMVVDPVSGADKWRFTGFYGEARKENRHRSWELMHFLSVQSDAPWLCA 391 Query: 81 GDFNEVLNANEHF--FQRRQR 25 GDFNE+L ANE F QR +R Sbjct: 392 GDFNEILEANEQFGGVQRPER 412