BLASTX nr result
ID: Lithospermum22_contig00041826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041826 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007025921.1| cytochrome b6 [Vaccinium macrocarpon] gi|374... 58 9e-07 ref|YP_007475169.1| cytochrome b6 (chloroplast) [Arundinaria gig... 55 5e-06 ref|NP_043053.1| cytochrome b6 [Zea mays] gi|48478799|ref|YP_024... 55 5e-06 ref|XP_002457870.1| hypothetical protein SORBIDRAFT_03g017580 [S... 55 5e-06 emb|CAA32267.1| petB [Hordeum vulgare subsp. vulgare] 55 5e-06 >ref|YP_007025921.1| cytochrome b6 [Vaccinium macrocarpon] gi|374093729|gb|AEY84165.1| cytochrome b6 (chloroplast) [Vaccinium macrocarpon] gi|385198157|gb|AFI44075.1| cytochrome b6 [Vaccinium macrocarpon] Length = 226 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 262 GSSTYLNKIYDWFEECLEIQAITDDITSK*VP 167 GS TYLNK+YDWFEE LEIQAI DDITSK VP Sbjct: 7 GSLTYLNKVYDWFEERLEIQAIADDITSKYVP 38 >ref|YP_007475169.1| cytochrome b6 (chloroplast) [Arundinaria gigantea] gi|441480279|gb|AGC38191.1| cytochrome b6 (chloroplast) [Arundinaria gigantea] Length = 234 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 262 GSSTYLNKIYDWFEECLEIQAITDDITSK*VP 167 G TYLNK+YDWFEE LEIQAI DDITSK VP Sbjct: 15 GLVTYLNKVYDWFEERLEIQAIADDITSKYVP 46 >ref|NP_043053.1| cytochrome b6 [Zea mays] gi|48478799|ref|YP_024406.1| cytochrome b6 [Saccharum hybrid cultivar SP-80-3280] gi|118614521|ref|YP_899437.1| cytochrome b6 [Sorghum bicolor] gi|902251|emb|CAA60315.1| cytochrome B6 [Zea mays] gi|48478701|gb|AAT44721.1| cytochrome b6 [Saccharum hybrid cultivar SP80-3280] gi|118201155|gb|ABK79525.1| cytochrome b6 [Sorghum bicolor] Length = 234 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 262 GSSTYLNKIYDWFEECLEIQAITDDITSK*VP 167 G TYLNK+YDWFEE LEIQAI DDITSK VP Sbjct: 15 GLVTYLNKVYDWFEERLEIQAIADDITSKYVP 46 >ref|XP_002457870.1| hypothetical protein SORBIDRAFT_03g017580 [Sorghum bicolor] gi|12437|emb|CAA29000.1| unnamed protein product [Zea mays] gi|241929845|gb|EES02990.1| hypothetical protein SORBIDRAFT_03g017580 [Sorghum bicolor] gi|413933808|gb|AFW68359.1| cytochrome b6 [Zea mays] Length = 232 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 262 GSSTYLNKIYDWFEECLEIQAITDDITSK*VP 167 G TYLNK+YDWFEE LEIQAI DDITSK VP Sbjct: 13 GLVTYLNKVYDWFEERLEIQAIADDITSKYVP 44 >emb|CAA32267.1| petB [Hordeum vulgare subsp. vulgare] Length = 232 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 262 GSSTYLNKIYDWFEECLEIQAITDDITSK*VP 167 G TYLNK+YDWFEE LEIQAI DDITSK VP Sbjct: 13 GLVTYLNKVYDWFEERLEIQAIADDITSKYVP 44