BLASTX nr result
ID: Lithospermum22_contig00041716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041716 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002453601.1| hypothetical protein SORBIDRAFT_04g008820 [S... 55 6e-06 >ref|XP_002453601.1| hypothetical protein SORBIDRAFT_04g008820 [Sorghum bicolor] gi|241933432|gb|EES06577.1| hypothetical protein SORBIDRAFT_04g008820 [Sorghum bicolor] Length = 266 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -2 Query: 160 DIGWDYGIPI-LENRDHVKCSFCDTIYKGGITRLMYHLIGNNKKVAACKKCPA 5 D+GW+YG+ + N+D VKC CD KGGI RL HL K V KKCPA Sbjct: 21 DVGWEYGVLVDASNKDKVKCKLCDKEMKGGIYRLKEHLAHEGKNV---KKCPA 70