BLASTX nr result
ID: Lithospermum22_contig00041377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041377 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298371.1| predicted protein [Populus trichocarpa] gi|2... 75 5e-12 ref|XP_002866357.1| pentatricopeptide repeat-containing protein ... 72 6e-11 emb|CBI16176.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat... 70 2e-10 ref|NP_200798.1| pentatricopeptide repeat-containing protein [Ar... 68 7e-10 >ref|XP_002298371.1| predicted protein [Populus trichocarpa] gi|222845629|gb|EEE83176.1| predicted protein [Populus trichocarpa] Length = 915 Score = 75.1 bits (183), Expect = 5e-12 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +1 Query: 1 WDSMLKMGLKPDAVAYNFMIYGFCIAGELDKASKLRNEMVRSGLKPN 141 WD+ML GLKPD +AYNF+IYG CIAGEL KA +LR++M+R G+KPN Sbjct: 843 WDTMLNKGLKPDTLAYNFLIYGCCIAGELGKAFELRDDMIRRGVKPN 889 >ref|XP_002866357.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312192|gb|EFH42616.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 907 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/51 (58%), Positives = 42/51 (82%) Frame = +1 Query: 1 WDSMLKMGLKPDAVAYNFMIYGFCIAGELDKASKLRNEMVRSGLKPNPPSS 153 W+SM + G++PD VAYN +I+G C+AGE+ KA++LRNEM+R GLKPN +S Sbjct: 845 WNSMTEKGIRPDRVAYNTLIHGCCVAGEMGKATELRNEMLRQGLKPNTETS 895 >emb|CBI16176.3| unnamed protein product [Vitis vinifera] Length = 819 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +1 Query: 1 WDSMLKMGLKPDAVAYNFMIYGFCIAGELDKASKLRNEMVRSGLKPN 141 W+SML G+ PD VAYNF+IYG C+ GEL KA +LR++M+R G+KPN Sbjct: 735 WESMLNRGVNPDTVAYNFLIYGCCVTGELTKAFELRDDMMRRGVKPN 781 >ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vitis vinifera] Length = 900 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +1 Query: 1 WDSMLKMGLKPDAVAYNFMIYGFCIAGELDKASKLRNEMVRSGLKPN 141 W+SML G+ PD VAYNF+IYG C+ GEL KA +LR++M+R G+KPN Sbjct: 832 WESMLNRGVNPDTVAYNFLIYGCCVTGELTKAFELRDDMMRRGVKPN 878 >ref|NP_200798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171023|sp|Q9FJE6.1|PP437_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At5g59900 gi|9757911|dbj|BAB08358.1| unnamed protein product [Arabidopsis thaliana] gi|332009866|gb|AED97249.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 907 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +1 Query: 1 WDSMLKMGLKPDAVAYNFMIYGFCIAGELDKASKLRNEMVRSGLKPNPPSS 153 W+SM + G++PD VAYN +I+G C+AGE+ KA++LRNEM+R GL PN +S Sbjct: 845 WNSMTEKGIRPDRVAYNTLIHGCCVAGEMGKATELRNEMLRQGLIPNNKTS 895