BLASTX nr result
ID: Lithospermum22_contig00041261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041261 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524579.1| ubiquitin-protein ligase, putative [Ricinus ... 44 8e-06 >ref|XP_002524579.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223536132|gb|EEF37787.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 44.3 bits (103), Expect(2) = 8e-06 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 23 YGPPLQNLHLDCCFGIIDHRISFIFLRLSFGNC*SL-PVHYSMFGLHMLSIACTTVRNAT 199 YG L +LHLDCCFG+ D+ +S I + SL + + GL L+ C+ ++ Sbjct: 112 YGSRLHSLHLDCCFGLTDNGLSLITSGCPYLTVISLYRCNITDIGLETLANGCSALKQIN 171 Query: 200 LSYFP 214 LSY P Sbjct: 172 LSYCP 176 Score = 30.0 bits (66), Expect(2) = 8e-06 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 259 KVSDFQIIYGIGF*IRSPLLPIIEADSCNLKRK 357 K+S + I G+GF SP L I+A+SCNL K Sbjct: 197 KISCCREISGVGFTGCSPTLAYIDAESCNLDPK 229