BLASTX nr result
ID: Lithospermum22_contig00041221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041221 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA46147.1| TPA: hypothetical protein ZEAMMB73_264885 [Zea m... 58 7e-07 ref|XP_002530647.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >tpg|DAA46147.1| TPA: hypothetical protein ZEAMMB73_264885 [Zea mays] Length = 127 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +2 Query: 17 GWKVSKHGCLSLIKEQRSRFYIVRKCVVMLIFWHKYGKV 133 G V++ GCL++ +EQRSRFYI R+CV MLI WHKY K+ Sbjct: 89 GGGVARRGCLAVAREQRSRFYIFRRCVAMLICWHKYKKI 127 >ref|XP_002530647.1| conserved hypothetical protein [Ricinus communis] gi|223529820|gb|EEF31755.1| conserved hypothetical protein [Ricinus communis] Length = 58 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +2 Query: 32 KHGCLSLIKEQRSRFYIVRKCVVMLIFWHKYG 127 +HG ++++KEQRSR YIVRKCVV+L+ WHKYG Sbjct: 25 RHGWITIVKEQRSRLYIVRKCVVILVCWHKYG 56