BLASTX nr result
ID: Lithospermum22_contig00041168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041168 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis ... 77 2e-12 ref|XP_002282442.1| PREDICTED: potassium channel AKT1 [Vitis vin... 77 2e-12 emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera] 77 2e-12 ref|XP_003609240.1| Potassium channel [Medicago truncatula] gi|3... 74 9e-12 ref|XP_003526425.1| PREDICTED: potassium channel AKT1-like [Glyc... 72 4e-11 >emb|CBW30481.1| inward rectifying shaker-like K+ channel [Vitis vinifera] gi|310913174|emb|CBW30482.1| inward rectifying shaker-like K+ channel [Vitis vinifera] Length = 898 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 136 LPHAVLPKPSSTYGYFGLLRLWRLRRVSKMFARLEKDRNYSYFWV 270 L +LPKP YGYF +LRLWRLRRVS MFARLEKDRN++YFWV Sbjct: 159 LARKILPKPLKEYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWV 203 >ref|XP_002282442.1| PREDICTED: potassium channel AKT1 [Vitis vinifera] gi|296081992|emb|CBI20997.3| unnamed protein product [Vitis vinifera] Length = 898 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 136 LPHAVLPKPSSTYGYFGLLRLWRLRRVSKMFARLEKDRNYSYFWV 270 L +LPKP YGYF +LRLWRLRRVS MFARLEKDRN++YFWV Sbjct: 159 LARKILPKPLKEYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWV 203 >emb|CAN78157.1| hypothetical protein VITISV_032798 [Vitis vinifera] Length = 898 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 136 LPHAVLPKPSSTYGYFGLLRLWRLRRVSKMFARLEKDRNYSYFWV 270 L +LPKP YGYF +LRLWRLRRVS MFARLEKDRN++YFWV Sbjct: 159 LARKILPKPLKEYGYFNMLRLWRLRRVSSMFARLEKDRNFNYFWV 203 >ref|XP_003609240.1| Potassium channel [Medicago truncatula] gi|355510295|gb|AES91437.1| Potassium channel [Medicago truncatula] Length = 888 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +1 Query: 115 SVEPRDVLPHAVLPKPSSTYGYFGLLRLWRLRRVSKMFARLEKDRNYSYFWV 270 S+ P +++ H + P P TYG F +LRLWRLRRVS MF+RLEKDRNY+YFWV Sbjct: 139 SIIPSELVAH-ISPAPMQTYGLFNMLRLWRLRRVSAMFSRLEKDRNYNYFWV 189 >ref|XP_003526425.1| PREDICTED: potassium channel AKT1-like [Glycine max] Length = 879 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +1 Query: 148 VLPKPSSTYGYFGLLRLWRLRRVSKMFARLEKDRNYSYFWVDRWCSSVL 294 VLP P YG F +LRLWRLRRVS MFARLEKDRNY+YFWV CS ++ Sbjct: 171 VLPPPFKQYGMFNILRLWRLRRVSAMFARLEKDRNYNYFWVR--CSKLI 217