BLASTX nr result
ID: Lithospermum22_contig00041011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041011 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511103.1| phosphoprotein phosphatase, putative [Ricinu... 65 7e-09 ref|XP_002321746.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002318165.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002511103.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223550218|gb|EEF51705.1| phosphoprotein phosphatase, putative [Ricinus communis] Length = 951 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = -1 Query: 184 LHLNKEEEEKEFDLGSEEPESPFPL----RVLCMLGDITVGQAHRFTHWL 47 LH +EEEKE DLGSEEP++P PL RVL MLGDIT G A+RF+ WL Sbjct: 18 LHPQDKEEEKELDLGSEEPDAPLPLTVTSRVLYMLGDITAGPAYRFSQWL 67 >ref|XP_002321746.1| predicted protein [Populus trichocarpa] gi|222868742|gb|EEF05873.1| predicted protein [Populus trichocarpa] Length = 937 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 5/67 (7%) Frame = -1 Query: 232 IVSKTKKMANLHK-EDPLHLNKEEEEKEFDLGSEEPESPFPL----RVLCMLGDITVGQA 68 ++SK +K A+L + + + ++EEE+E DLGSEE + P PL RVL MLGDIT G A Sbjct: 1 MMSKDEKEASLSVINNTIEVQEKEEERELDLGSEELDPPLPLTVTSRVLYMLGDITAGPA 60 Query: 67 HRFTHWL 47 +RF WL Sbjct: 61 YRFAQWL 67 >ref|XP_002318165.1| predicted protein [Populus trichocarpa] gi|222858838|gb|EEE96385.1| predicted protein [Populus trichocarpa] Length = 933 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/64 (50%), Positives = 38/64 (59%), Gaps = 9/64 (14%) Frame = -1 Query: 211 MANLHKEDPLHL-----NKEEEEKEFDLGSEEPESPFP----LRVLCMLGDITVGQAHRF 59 M+ KED L + +EEE+E DLGSEE + P P RVL MLGDIT G A+RF Sbjct: 2 MSKDEKEDTLSIINTTVQVQEEERELDLGSEELDPPLPPTVTSRVLYMLGDITAGPAYRF 61 Query: 58 THWL 47 WL Sbjct: 62 AQWL 65