BLASTX nr result
ID: Lithospermum22_contig00041003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00041003 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC26250.1| contains similarity to reverse transcriptase (Pfa... 58 7e-07 >gb|AAC26250.1| contains similarity to reverse transcriptase (Pfam: rvt.hmm, score 19.29) [Arabidopsis thaliana] gi|7267136|emb|CAB80804.1| putative retrotransposon protein [Arabidopsis thaliana] Length = 964 Score = 58.2 bits (139), Expect = 7e-07 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Frame = +1 Query: 133 QPTLRRFERNRR*PNH---WYGE---AFLVESHESTSYEEAITSTDTDTRLIVMKSDMDS 294 +P +RR ER+R P+ W + F++ES E TSYEEA+ D+D L KS+M+S Sbjct: 408 EPEVRRSERSRHEPDRFRDWVMDDHALFMIESDEPTSYEEALMGPDSDKWLEAAKSEMES 467 Query: 295 MYQKKV*SLLDLLNGVPRLSVNGYSKRNM 381 M Q KV +L+DL +GV + K+ + Sbjct: 468 MSQNKVWTLVDLPDGVKPIECKWIFKKKI 496