BLASTX nr result
ID: Lithospermum22_contig00040876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040876 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532658.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-30 ref|XP_004137032.1| PREDICTED: pentatricopeptide repeat-containi... 136 2e-30 emb|CBI22024.3| unnamed protein product [Vitis vinifera] 130 1e-28 ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 ref|XP_003520116.1| PREDICTED: pentatricopeptide repeat-containi... 128 5e-28 >ref|XP_003532658.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Glycine max] Length = 674 Score = 136 bits (343), Expect = 2e-30 Identities = 68/81 (83%), Positives = 71/81 (87%) Frame = -1 Query: 245 PDTSSVLHDMDAEEKEYNLLHHSEKLAIAFALMNTPEGTTIRVMKNVRVCSDCHAAIKCI 66 PDTSSVLHDMD EEKE L HHSEKLAIAFALMNTPEG IRVMKN+RVCSDCH AIK I Sbjct: 585 PDTSSVLHDMDNEEKEQILRHHSEKLAIAFALMNTPEGVPIRVMKNLRVCSDCHVAIKYI 644 Query: 65 SLIKKREIIVRDASRFHHFKD 3 S IKK EIIVRD+SRFHHFK+ Sbjct: 645 SEIKKLEIIVRDSSRFHHFKN 665 >ref|XP_004137032.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Cucumis sativus] gi|449526872|ref|XP_004170437.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Cucumis sativus] Length = 667 Score = 136 bits (342), Expect = 2e-30 Identities = 65/81 (80%), Positives = 68/81 (83%) Frame = -1 Query: 245 PDTSSVLHDMDAEEKEYNLLHHSEKLAIAFALMNTPEGTTIRVMKNVRVCSDCHAAIKCI 66 P+ SVLHDMD EEKEYNL HHSEK AIAFALMNT E IRVMKN+RVC DCH AIKCI Sbjct: 578 PELGSVLHDMDNEEKEYNLAHHSEKFAIAFALMNTSENVPIRVMKNLRVCDDCHNAIKCI 637 Query: 65 SLIKKREIIVRDASRFHHFKD 3 S I+ REIIVRDASRFHHFKD Sbjct: 638 SRIRNREIIVRDASRFHHFKD 658 >emb|CBI22024.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 130 bits (327), Expect = 1e-28 Identities = 62/81 (76%), Positives = 70/81 (86%) Frame = -1 Query: 245 PDTSSVLHDMDAEEKEYNLLHHSEKLAIAFALMNTPEGTTIRVMKNVRVCSDCHAAIKCI 66 PD SVLHDMD E+KEY+L+HHSEKLAIAFAL+ TP GT IRV+KN+RVCSDCH AIK I Sbjct: 30 PDIDSVLHDMDVEDKEYSLVHHSEKLAIAFALLYTPVGTPIRVIKNLRVCSDCHVAIKYI 89 Query: 65 SLIKKREIIVRDASRFHHFKD 3 S I REIIVRD+SRFHHFK+ Sbjct: 90 SEISNREIIVRDSSRFHHFKN 110 >ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Vitis vinifera] Length = 657 Score = 130 bits (327), Expect = 1e-28 Identities = 62/81 (76%), Positives = 70/81 (86%) Frame = -1 Query: 245 PDTSSVLHDMDAEEKEYNLLHHSEKLAIAFALMNTPEGTTIRVMKNVRVCSDCHAAIKCI 66 PD SVLHDMD E+KEY+L+HHSEKLAIAFAL+ TP GT IRV+KN+RVCSDCH AIK I Sbjct: 568 PDIDSVLHDMDVEDKEYSLVHHSEKLAIAFALLYTPVGTPIRVIKNLRVCSDCHVAIKYI 627 Query: 65 SLIKKREIIVRDASRFHHFKD 3 S I REIIVRD+SRFHHFK+ Sbjct: 628 SEISNREIIVRDSSRFHHFKN 648 >ref|XP_003520116.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] Length = 785 Score = 128 bits (321), Expect = 5e-28 Identities = 59/81 (72%), Positives = 73/81 (90%) Frame = -1 Query: 245 PDTSSVLHDMDAEEKEYNLLHHSEKLAIAFALMNTPEGTTIRVMKNVRVCSDCHAAIKCI 66 PDT+SVLHD++ E KE L HHSEKLAIAFAL+NTP+ TT+R+MKN+RVC+DCH+AI+ I Sbjct: 696 PDTNSVLHDLEQEVKEQILRHHSEKLAIAFALINTPKHTTVRIMKNLRVCNDCHSAIRYI 755 Query: 65 SLIKKREIIVRDASRFHHFKD 3 SL+ +REIIVRDA+RFHHFKD Sbjct: 756 SLLVEREIIVRDATRFHHFKD 776