BLASTX nr result
ID: Lithospermum22_contig00040870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040870 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001385202.2| protein required for glucose repression and ... 56 3e-06 >ref|XP_001385202.2| protein required for glucose repression and for glucose and cation transport [Scheffersomyces stipitis CBS 6054] gi|149387082|gb|ABN67173.2| protein required for glucose repression and for glucose and cation transport [Scheffersomyces stipitis CBS 6054] Length = 725 Score = 55.8 bits (133), Expect = 3e-06 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 7/118 (5%) Frame = -3 Query: 347 NDDAILDFIAQNCPNLKHLSFHGSSNASEEAILKVIQNCTKLELVDFSNSPYFCYSVLEK 168 +++AIL+ + ++CP LK + F+ S+N S+E+ILK+ NC L +D N P L+K Sbjct: 262 SEEAILNLL-ESCPMLKRVKFNNSNNISDESILKMYDNCKSLVEIDLHNCPKVTDKYLKK 320 Query: 167 LSISCPNLRGIRRNGYVEPSFASALNELFP------CLQLLNLSN-STISDKDLLTLV 15 + + LR R + P L EL P L+++++S + I+DK + LV Sbjct: 321 IFLDLSQLREFRISN--APGITDKLFELLPEGFYLEKLRIIDISGCNAITDKLVEKLV 376