BLASTX nr result
ID: Lithospermum22_contig00040820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040820 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300694.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002510569.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002300694.1| predicted protein [Populus trichocarpa] gi|222842420|gb|EEE79967.1| predicted protein [Populus trichocarpa] Length = 284 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Frame = +1 Query: 1 IQMEL-DSDDQDWLYCKKKPDNQSEKKLKPXXXXXXXXXXXXLWPRARFIPEADIYALPF 177 +Q EL DSDD++WL+ K + K+L LWPRA ++PE+D+YALP+ Sbjct: 222 LQFELKDSDDEEWLFGTLKQERHGNKRLNARHDISCRESST-LWPRAHYLPESDVYALPY 280 Query: 178 TVPF 189 T+PF Sbjct: 281 TIPF 284 >ref|XP_002510569.1| conserved hypothetical protein [Ricinus communis] gi|223551270|gb|EEF52756.1| conserved hypothetical protein [Ricinus communis] Length = 301 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/56 (44%), Positives = 33/56 (58%) Frame = +1 Query: 22 DDQDWLYCKKKPDNQSEKKLKPXXXXXXXXXXXXLWPRARFIPEADIYALPFTVPF 189 DD DWL C K+ + +K+L+ WP ARF+P ADIYALP+T+PF Sbjct: 247 DDCDWLCCSKRQERSRDKRLQ-ISHDEPANEGLGFWPCARFLPHADIYALPYTIPF 301