BLASTX nr result
ID: Lithospermum22_contig00040780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040780 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA37392.1| TPA: hypothetical protein ZEAMMB73_988969 [Zea m... 55 8e-06 ref|XP_002447994.1| hypothetical protein SORBIDRAFT_06g019450 [S... 55 8e-06 >tpg|DAA37392.1| TPA: hypothetical protein ZEAMMB73_988969 [Zea mays] Length = 1033 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 QVVEIPVVDVQSMEGPAQSAIQYFENMRNFLLA 3 +VVE PV+ VQ+ +GPAQSAIQYFENMRNFL+A Sbjct: 76 KVVENPVITVQTFDGPAQSAIQYFENMRNFLVA 108 >ref|XP_002447994.1| hypothetical protein SORBIDRAFT_06g019450 [Sorghum bicolor] gi|241939177|gb|EES12322.1| hypothetical protein SORBIDRAFT_06g019450 [Sorghum bicolor] Length = 963 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 101 QVVEIPVVDVQSMEGPAQSAIQYFENMRNFLLA 3 +VVE PV+ VQ+ +GPAQSAIQYFENMRNFL+A Sbjct: 76 KVVENPVITVQTFDGPAQSAIQYFENMRNFLVA 108