BLASTX nr result
ID: Lithospermum22_contig00040563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040563 (573 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312277.1| predicted protein [Populus trichocarpa] gi|2... 56 5e-06 ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat rece... 56 5e-06 ref|XP_002512112.1| serine-threonine protein kinase, plant-type,... 55 6e-06 >ref|XP_002312277.1| predicted protein [Populus trichocarpa] gi|222852097|gb|EEE89644.1| predicted protein [Populus trichocarpa] Length = 327 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +2 Query: 2 DMYIEGNSFKDGVNPIGVHKVLELSDTDF 88 ++Y+EGN+FK GVNPIGVHKVLE+SDTDF Sbjct: 297 ELYVEGNAFKPGVNPIGVHKVLEVSDTDF 325 >ref|XP_002269214.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710 [Vitis vinifera] gi|297738074|emb|CBI27275.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 55.8 bits (133), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 2 DMYIEGNSFKDGVNPIGVHKVLELSDTDFTF 94 +MYIEGN+F+ GV PIGVHKVLE+SDTDF F Sbjct: 299 EMYIEGNAFRPGVKPIGVHKVLEVSDTDFLF 329 >ref|XP_002512112.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549292|gb|EEF50781.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 300 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 DMYIEGNSFKDGVNPIGVHKVLELSDTDF 88 +MYIEGN+FK GVNPIGVHKVLE+SD DF Sbjct: 270 EMYIEGNAFKPGVNPIGVHKVLEVSDADF 298