BLASTX nr result
ID: Lithospermum22_contig00040560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040560 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002962388.1| hypothetical protein SELMODRAFT_78854 [Selag... 59 3e-07 ref|XP_002965606.1| hypothetical protein SELMODRAFT_84331 [Selag... 59 3e-07 ref|NP_187351.2| tRNA pseudouridine synthase A [Arabidopsis thal... 58 7e-07 dbj|BAF00823.1| putative tRNA pseudouridine synthase [Arabidopsi... 58 7e-07 ref|XP_003541334.1| PREDICTED: tRNA pseudouridine synthase A 1-l... 57 1e-06 >ref|XP_002962388.1| hypothetical protein SELMODRAFT_78854 [Selaginella moellendorffii] gi|300169249|gb|EFJ35851.1| hypothetical protein SELMODRAFT_78854 [Selaginella moellendorffii] Length = 268 Score = 59.3 bits (142), Expect = 3e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 90 KWRLVIAYDGARFSGWQYQPTLPTVQGIVE 1 KWR+V++YDG RFSGWQYQP PTVQG++E Sbjct: 1 KWRIVVSYDGTRFSGWQYQPDFPTVQGLIE 30 >ref|XP_002965606.1| hypothetical protein SELMODRAFT_84331 [Selaginella moellendorffii] gi|300166420|gb|EFJ33026.1| hypothetical protein SELMODRAFT_84331 [Selaginella moellendorffii] Length = 269 Score = 59.3 bits (142), Expect = 3e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 90 KWRLVIAYDGARFSGWQYQPTLPTVQGIVE 1 KWR+V++YDG RFSGWQYQP PTVQG++E Sbjct: 1 KWRIVVSYDGTRFSGWQYQPDFPTVQGLIE 30 >ref|NP_187351.2| tRNA pseudouridine synthase A [Arabidopsis thaliana] gi|119360081|gb|ABL66769.1| At3g06950 [Arabidopsis thaliana] gi|332640958|gb|AEE74479.1| tRNA pseudouridine synthase A [Arabidopsis thaliana] Length = 323 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 6/71 (8%) Frame = -3 Query: 195 LQCFTP------FPLQVKSSIEGEHHPSCNGDMKTLMQPPYKWRLVIAYDGARFSGWQYQ 34 + C TP F SS + + N +K YKWRLVIAYDG RF+GWQYQ Sbjct: 1 MSCVTPALPPSLFTNGYLSSPQNISMTNLNSSVKVSDSGAYKWRLVIAYDGTRFAGWQYQ 60 Query: 33 PTLPTVQGIVE 1 + PT+Q ++E Sbjct: 61 ESPPTIQSMLE 71 >dbj|BAF00823.1| putative tRNA pseudouridine synthase [Arabidopsis thaliana] Length = 323 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 6/71 (8%) Frame = -3 Query: 195 LQCFTP------FPLQVKSSIEGEHHPSCNGDMKTLMQPPYKWRLVIAYDGARFSGWQYQ 34 + C TP F SS + + N +K YKWRLVIAYDG RF+GWQYQ Sbjct: 1 MSCVTPALPPSLFTNGYLSSPQNISMTNLNSSVKVSGSGAYKWRLVIAYDGTRFAGWQYQ 60 Query: 33 PTLPTVQGIVE 1 + PT+Q ++E Sbjct: 61 ESPPTIQSMLE 71 >ref|XP_003541334.1| PREDICTED: tRNA pseudouridine synthase A 1-like [Glycine max] Length = 327 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = -3 Query: 183 TPFP-LQVKSSIEGEHHPSCNGDMKTLMQPPYKWRLVIAYDGARFSGWQYQPTLPTVQGI 7 TP P L + +E EH +G L+Q YKWR+V+AYDG +++GWQYQ + PTVQ Sbjct: 16 TPIPFLNSTAPVELEHG---HGHGVKLIQDGYKWRIVLAYDGTQYAGWQYQESPPTVQCT 72 Query: 6 VE 1 VE Sbjct: 73 VE 74