BLASTX nr result
ID: Lithospermum22_contig00040200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040200 (502 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [... 85 7e-15 ref|XP_003570330.1| PREDICTED: calcineurin subunit B-like [Brach... 84 1e-14 gb|AFC88294.1| calcineurin-like protein [Hevea brasiliensis] 83 3e-14 ref|XP_002454721.1| hypothetical protein SORBIDRAFT_04g036210 [S... 83 3e-14 ref|NP_001151790.1| calcineurin subunit B [Zea mays] gi|19564970... 83 3e-14 >ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [Vitis vinifera] gi|297743542|emb|CBI36409.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/54 (72%), Positives = 48/54 (88%) Frame = -2 Query: 501 DLSGSFMSDQQREEVLSHVLSEAGYTRESTLMLEDFIKILDYPGLKMEVEVPVD 340 DL+GSFMSD+QRE+VLSHVL EAGYTRES+ +LEDFIK+L +KM+VE+PVD Sbjct: 122 DLTGSFMSDKQREQVLSHVLQEAGYTRESSFLLEDFIKVLGSSSIKMDVEIPVD 175 >ref|XP_003570330.1| PREDICTED: calcineurin subunit B-like [Brachypodium distachyon] Length = 175 Score = 84.0 bits (206), Expect = 1e-14 Identities = 39/54 (72%), Positives = 49/54 (90%) Frame = -2 Query: 501 DLSGSFMSDQQREEVLSHVLSEAGYTRESTLMLEDFIKILDYPGLKMEVEVPVD 340 DL+GS MS++QREEVL+ VL EAGYT++STL LEDF+ I+D+PGLKMEVEVP+D Sbjct: 122 DLTGSSMSEKQREEVLTKVLEEAGYTKDSTLSLEDFMTIIDHPGLKMEVEVPID 175 >gb|AFC88294.1| calcineurin-like protein [Hevea brasiliensis] Length = 175 Score = 82.8 bits (203), Expect = 3e-14 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -2 Query: 501 DLSGSFMSDQQREEVLSHVLSEAGYTRESTLMLEDFIKILDYPGLKMEVEVPVD 340 DLSGSFMSD+QRE+VL VL EA YTRES LML+DFIK+ + GLKMEVEVPVD Sbjct: 122 DLSGSFMSDEQREQVLCQVLKEAAYTRESYLMLDDFIKVFGHFGLKMEVEVPVD 175 >ref|XP_002454721.1| hypothetical protein SORBIDRAFT_04g036210 [Sorghum bicolor] gi|241934552|gb|EES07697.1| hypothetical protein SORBIDRAFT_04g036210 [Sorghum bicolor] Length = 175 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 501 DLSGSFMSDQQREEVLSHVLSEAGYTRESTLMLEDFIKILDYPGLKMEVEVPVD 340 DL+GSFMS++QRE+V++ VL EAGYTR+ LEDFI+I+D+PGLKMEVEVP+D Sbjct: 122 DLTGSFMSEEQREQVVTKVLEEAGYTRDCAFSLEDFIQIIDHPGLKMEVEVPID 175 >ref|NP_001151790.1| calcineurin subunit B [Zea mays] gi|195649701|gb|ACG44318.1| calcineurin subunit B [Zea mays] gi|413924193|gb|AFW64125.1| calcineurin subunit B [Zea mays] Length = 175 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -2 Query: 501 DLSGSFMSDQQREEVLSHVLSEAGYTRESTLMLEDFIKILDYPGLKMEVEVPVD 340 DL+GSFMS++QRE+V++ VL EAGYTR+ LEDFI+I+D+PGLKMEVEVP+D Sbjct: 122 DLTGSFMSEEQREQVVTEVLEEAGYTRDYAFSLEDFIQIIDHPGLKMEVEVPID 175