BLASTX nr result
ID: Lithospermum22_contig00040071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040071 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152286.1| PREDICTED: PTI1-like tyrosine-protein kinase... 64 1e-08 ref|XP_002876497.1| hypothetical protein ARALYDRAFT_486400 [Arab... 57 2e-06 >ref|XP_004152286.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Cucumis sativus] gi|449502300|ref|XP_004161602.1| PREDICTED: PTI1-like tyrosine-protein kinase 3-like [Cucumis sativus] Length = 471 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -2 Query: 119 LITHAPPPGHFMRLDNTRAEDDLYISKRSKMRRWLCC 9 L HAPPPG+F+RL NT ++DDLY+SK+ +MRRWLCC Sbjct: 79 LKAHAPPPGYFVRLKNTGSKDDLYLSKKDRMRRWLCC 115 >ref|XP_002876497.1| hypothetical protein ARALYDRAFT_486400 [Arabidopsis lyrata subsp. lyrata] gi|297322335|gb|EFH52756.1| hypothetical protein ARALYDRAFT_486400 [Arabidopsis lyrata subsp. lyrata] Length = 405 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -2 Query: 119 LITHAPPPGHFMRLDNTRAEDDLYISKRSKMRRWLCC 9 L+ + P HF+RLD RA DDLYI KR KMRRWLCC Sbjct: 10 LVANDRSPAHFVRLDKPRAVDDLYIGKREKMRRWLCC 46