BLASTX nr result
ID: Lithospermum22_contig00040008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00040008 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Viti... 57 1e-06 ref|NP_174350.2| UDP-arabinose 4-epimerase [Arabidopsis thaliana... 56 4e-06 ref|XP_002890883.1| hypothetical protein ARALYDRAFT_890616 [Arab... 56 4e-06 gb|AAN60309.1| unknown [Arabidopsis thaliana] 56 4e-06 >ref|XP_002270765.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Vitis vinifera] gi|297740899|emb|CBI31081.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -1 Query: 151 SQLPRKLFLAAGITALCFILFRQTGFNSTSQYFSRKEPGITHVLVTGGAG 2 S + K+ LAA +TALC ++ +Q+ +T FSR EPG+THVLVTGGAG Sbjct: 31 SNVVGKILLAATLTALCILMLKQSSNFNTPSPFSRHEPGVTHVLVTGGAG 80 >ref|NP_174350.2| UDP-arabinose 4-epimerase [Arabidopsis thaliana] gi|79318985|ref|NP_001031118.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] gi|75313130|sp|Q9SA77.1|ARAE1_ARATH RecName: Full=UDP-arabinose 4-epimerase 1; AltName: Full=UDP-D-xylose 4-epimerase 1 gi|4587518|gb|AAD25749.1|AC007060_7 Strong similarity to F19I3.8 gi|3033381 putative UDP-galactose-4-epimerase from Arabidopsis thaliana BAC gb|AC004238 and is a member of PF|01370 the NAD dependent epimerase/dehydratase family. EST gb|AA597338 comes from this gene [Arabidopsis thaliana] gi|13272475|gb|AAK17176.1|AF325108_1 unknown protein [Arabidopsis thaliana] gi|18086329|gb|AAL57628.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|27363222|gb|AAO11530.1| At1g30620/T5I8_7 [Arabidopsis thaliana] gi|28395529|gb|AAO39213.1| UDP-D-xylose 4-epimerase [Arabidopsis thaliana] gi|222423784|dbj|BAH19858.1| AT1G30620 [Arabidopsis thaliana] gi|332193130|gb|AEE31251.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] gi|332193131|gb|AEE31252.1| UDP-arabinose 4-epimerase [Arabidopsis thaliana] Length = 419 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 136 KLFLAAGITALCFILFRQTGFNSTSQYFSRKEPGITHVLVTGGAG 2 K+ L A +TALC + +Q+ +T FSR EPG+THVLVTGGAG Sbjct: 36 KILLTASLTALCIFMLKQSPTFNTPSVFSRHEPGVTHVLVTGGAG 80 >ref|XP_002890883.1| hypothetical protein ARALYDRAFT_890616 [Arabidopsis lyrata subsp. lyrata] gi|297336725|gb|EFH67142.1| hypothetical protein ARALYDRAFT_890616 [Arabidopsis lyrata subsp. lyrata] Length = 418 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 136 KLFLAAGITALCFILFRQTGFNSTSQYFSRKEPGITHVLVTGGAG 2 K+ L A +TALC + +Q+ +T FSR EPG+THVLVTGGAG Sbjct: 36 KILLTASLTALCIFMLKQSPTFNTPSVFSRHEPGVTHVLVTGGAG 80 >gb|AAN60309.1| unknown [Arabidopsis thaliana] Length = 419 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 136 KLFLAAGITALCFILFRQTGFNSTSQYFSRKEPGITHVLVTGGAG 2 K+ L A +TALC + +Q+ +T FSR EPG+THVLVTGGAG Sbjct: 36 KILLTASLTALCIFMLKQSPTFNTPSVFSRHEPGVTHVLVTGGAG 80