BLASTX nr result
ID: Lithospermum22_contig00039983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039983 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148126.1| PREDICTED: 65-kDa microtubule-associated pro... 76 3e-12 ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated pro... 75 4e-12 ref|XP_002273473.2| PREDICTED: 65-kDa microtubule-associated pro... 75 7e-12 ref|XP_002513279.1| Protein regulator of cytokinesis, putative [... 74 1e-11 ref|XP_002511727.1| PLE, putative [Ricinus communis] gi|22354890... 72 6e-11 >ref|XP_004148126.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis sativus] gi|449499658|ref|XP_004160877.1| PREDICTED: 65-kDa microtubule-associated protein 3-like [Cucumis sativus] Length = 730 Score = 75.9 bits (185), Expect = 3e-12 Identities = 48/98 (48%), Positives = 62/98 (63%), Gaps = 8/98 (8%) Frame = +3 Query: 33 IQDLNRSIIEFNEAPAVSKTPLATPTKKVSIYEVNATPKTMPIPVPNTPSTVSIAMQTAM 212 + DLN + + N + SKTP+ T SI E TPK +PIP+P+TPSTVS+ MQTAM Sbjct: 630 LNDLNEKLQKLNMSS--SKTPIKT----TSISEEVITPKIIPIPLPSTPSTVSVPMQTAM 683 Query: 213 TPATP-------GINRHL-ENMEYSFEEKRAGFIPIKA 302 TPA P I+ + E +EYSFEE+RAGF+ KA Sbjct: 684 TPALPHPVDLTARISEDISEVVEYSFEERRAGFVLPKA 721 >ref|XP_002267584.1| PREDICTED: 65-kDa microtubule-associated protein 3 [Vitis vinifera] gi|296084125|emb|CBI24513.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 75.5 bits (184), Expect = 4e-12 Identities = 45/97 (46%), Positives = 59/97 (60%), Gaps = 11/97 (11%) Frame = +3 Query: 33 IQDLNRSIIEF-NEAPAVSKTPLATPTKKV-----SIYEVNATPKTMPIPVPNTPSTVSI 194 ++DLNR + ++ + + P TP+K + E N TPKTMPIPVP+TPSTVS+ Sbjct: 622 LEDLNRPQPKILHKTVSSNNIPYTTPSKSQLPPPSATDEENRTPKTMPIPVPSTPSTVSV 681 Query: 195 AMQTAMTPATPGI-----NRHLENMEYSFEEKRAGFI 290 M TAMTPA P +E EYSFEE+RAGF+ Sbjct: 682 PMLTAMTPAPPPAPVPYNANPVEETEYSFEERRAGFV 718 >ref|XP_002273473.2| PREDICTED: 65-kDa microtubule-associated protein 3-like [Vitis vinifera] Length = 725 Score = 74.7 bits (182), Expect = 7e-12 Identities = 40/77 (51%), Positives = 53/77 (68%), Gaps = 8/77 (10%) Frame = +3 Query: 84 SKTPLATPTKKVSIYEV-NATPKTMPIPVPNTPSTVSIAMQTAMTPATPGI-------NR 239 SKTP A+P+K +SI ++ N TPK +PIP+P TP TVS+ MQTA TP TP I Sbjct: 641 SKTPTASPSKLISIDDLENKTPKNIPIPLPTTPPTVSLPMQTASTPGTPCIPFVANQAEG 700 Query: 240 HLENMEYSFEEKRAGFI 290 ++ +EYSFEE+RA F+ Sbjct: 701 RVKVIEYSFEERRAAFM 717 >ref|XP_002513279.1| Protein regulator of cytokinesis, putative [Ricinus communis] gi|223547653|gb|EEF49147.1| Protein regulator of cytokinesis, putative [Ricinus communis] Length = 724 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/79 (50%), Positives = 48/79 (60%), Gaps = 9/79 (11%) Frame = +3 Query: 81 VSKTPLATPTKKVSIYEVNATPKTMPIPVPNTPSTVSIAMQTAMTPATP---------GI 233 + K TP+K E N TPKTMPIPVP TPST+S+ MQTA+TPA P Sbjct: 635 IKKIVTTTPSKTTMADEENWTPKTMPIPVPTTPSTLSVPMQTAITPAHPVPVPYGGATPK 694 Query: 234 NRHLENMEYSFEEKRAGFI 290 E +EYSFEE+RAGF+ Sbjct: 695 EEVPEEVEYSFEERRAGFV 713 >ref|XP_002511727.1| PLE, putative [Ricinus communis] gi|223548907|gb|EEF50396.1| PLE, putative [Ricinus communis] Length = 725 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/76 (48%), Positives = 50/76 (65%), Gaps = 8/76 (10%) Frame = +3 Query: 87 KTPLATPTKKVSIYE-VNATPKTMPIPVPNTPSTVSIAMQTAMTPATPGIN-------RH 242 KTP+ TPT+ +S + V TPKT+PIPVP TP+T+S M A TPATP ++ + Sbjct: 627 KTPIRTPTRPISAGDAVTTTPKTLPIPVPTTPTTISTPMLMASTPATPCVSSAASTAEKV 686 Query: 243 LENMEYSFEEKRAGFI 290 +E +EYSFEE R G + Sbjct: 687 VEQIEYSFEEVRVGIL 702