BLASTX nr result
ID: Lithospermum22_contig00039700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039700 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155174.1| PREDICTED: uncharacterized LOC101207141 [Cuc... 67 1e-09 ref|XP_004133802.1| PREDICTED: uncharacterized protein LOC101207... 67 1e-09 ref|XP_002523304.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|NP_680550.1| NC domain-containing protein-like protein [Arab... 66 3e-09 ref|NP_001239945.1| uncharacterized protein LOC100797242 [Glycin... 66 3e-09 >ref|XP_004155174.1| PREDICTED: uncharacterized LOC101207141 [Cucumis sativus] Length = 286 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 MGLLSNRVERDQIKPGDHIYTYRAVFAYSHHG 1 MGL+SNRVER +IKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLISNRVERSEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_004133802.1| PREDICTED: uncharacterized protein LOC101207141 [Cucumis sativus] Length = 253 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 MGLLSNRVERDQIKPGDHIYTYRAVFAYSHHG 1 MGL+SNRVER +IKPGDHIYTYRAVFAYSHHG Sbjct: 1 MGLISNRVERSEIKPGDHIYTYRAVFAYSHHG 32 >ref|XP_002523304.1| conserved hypothetical protein [Ricinus communis] gi|223537392|gb|EEF39020.1| conserved hypothetical protein [Ricinus communis] Length = 258 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 96 MGLLSNRVERDQIKPGDHIYTYRAVFAYSHHG 1 MGLLSNRVER +IKPGDHIYTYRAVF YSHHG Sbjct: 1 MGLLSNRVERSEIKPGDHIYTYRAVFTYSHHG 32 >ref|NP_680550.1| NC domain-containing protein-like protein [Arabidopsis thaliana] gi|332656554|gb|AEE81954.1| NC domain-containing protein-like protein [Arabidopsis thaliana] Length = 263 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGLLSNRVERDQIKPGDHIYTYRAVFAYSHHG 1 MG+L+N+VERD++KPGDHIYTYRAVFAYSHHG Sbjct: 1 MGVLTNKVERDELKPGDHIYTYRAVFAYSHHG 32 >ref|NP_001239945.1| uncharacterized protein LOC100797242 [Glycine max] gi|255638656|gb|ACU19633.1| unknown [Glycine max] Length = 259 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 96 MGLLSNRVERDQIKPGDHIYTYRAVFAYSHHG 1 MGLLSNRVER +IKPGDHIYTYRAVF YSHHG Sbjct: 1 MGLLSNRVERHEIKPGDHIYTYRAVFTYSHHG 32