BLASTX nr result
ID: Lithospermum22_contig00039682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039682 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634110.1| PREDICTED: putative pentatricopeptide repeat... 77 1e-12 emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] 77 1e-12 ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago ... 75 4e-12 ref|XP_003549001.1| PREDICTED: putative pentatricopeptide repeat... 75 6e-12 ref|XP_002977518.1| hypothetical protein SELMODRAFT_107192 [Sela... 75 6e-12 >ref|XP_003634110.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Vitis vinifera] Length = 678 Score = 77.4 bits (189), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 4 CHIAAKLISKITGRAIIVRDTNRFHHFQNGICTCGDYW 117 CHIAAKLISKI GR I +RDTNRFHHF NG+C+CGDYW Sbjct: 641 CHIAAKLISKIVGREITIRDTNRFHHFYNGVCSCGDYW 678 >emb|CAN64485.1| hypothetical protein VITISV_035038 [Vitis vinifera] Length = 1740 Score = 77.4 bits (189), Expect = 1e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 4 CHIAAKLISKITGRAIIVRDTNRFHHFQNGICTCGDYW 117 CHIAAKLISKI GR I +RDTNRFHHF NG+C+CGDYW Sbjct: 1630 CHIAAKLISKIVGREITIRDTNRFHHFYNGVCSCGDYW 1667 >ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago truncatula] gi|355522693|gb|AET03147.1| hypothetical protein MTR_8g063290 [Medicago truncatula] Length = 659 Score = 75.5 bits (184), Expect = 4e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 4 CHIAAKLISKITGRAIIVRDTNRFHHFQNGICTCGDYW 117 CHIAAKLISKI R IIVRDTNRFHHF++G+C+CGDYW Sbjct: 622 CHIAAKLISKIVEREIIVRDTNRFHHFKDGVCSCGDYW 659 >ref|XP_003549001.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142-like [Glycine max] Length = 673 Score = 75.1 bits (183), Expect = 6e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 4 CHIAAKLISKITGRAIIVRDTNRFHHFQNGICTCGDYW 117 CHIAAKLISKI R I++RDTNRFHHF++GIC+CGDYW Sbjct: 636 CHIAAKLISKIVQREIVIRDTNRFHHFKDGICSCGDYW 673 >ref|XP_002977518.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii] gi|300154888|gb|EFJ21522.1| hypothetical protein SELMODRAFT_107192 [Selaginella moellendorffii] Length = 652 Score = 75.1 bits (183), Expect = 6e-12 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 4 CHIAAKLISKITGRAIIVRDTNRFHHFQNGICTCGDYW 117 CH A K+ISK+TGR I+VRDTNRFHHFQNG+C+C DYW Sbjct: 615 CHAATKVISKVTGREILVRDTNRFHHFQNGMCSCNDYW 652