BLASTX nr result
ID: Lithospermum22_contig00039426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00039426 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK49668.1| nuclear transcription factor Y subunit B18 [Medic... 90 2e-16 ref|XP_003534848.1| PREDICTED: nuclear transcription factor Y su... 90 2e-16 gb|AFK49666.1| nuclear transcription factor Y subunit B16 [Medic... 89 3e-16 gb|AFK36846.1| unknown [Medicago truncatula] 89 3e-16 ref|XP_003609646.1| Nuclear transcription factor Y subunit B-5 [... 89 3e-16 >gb|AFK49668.1| nuclear transcription factor Y subunit B18 [Medicago truncatula] Length = 208 Score = 90.1 bits (222), Expect = 2e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 152 REQERLLPIANVGRIMKQNLPQNAKISKDAKETMQECVSEFIGFVTSEAS 3 +EQ+RLLPIANVGRIMKQ LPQNAK+SK+AKETMQECVSEFI FVTSEAS Sbjct: 17 KEQDRLLPIANVGRIMKQILPQNAKVSKEAKETMQECVSEFISFVTSEAS 66 >ref|XP_003534848.1| PREDICTED: nuclear transcription factor Y subunit B-5-like [Glycine max] Length = 160 Score = 89.7 bits (221), Expect = 2e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 152 REQERLLPIANVGRIMKQNLPQNAKISKDAKETMQECVSEFIGFVTSEAS 3 +EQ+RLLPIANVGR+MKQ LPQNAKISK+AKETMQECVSEFI FVTSEAS Sbjct: 34 KEQDRLLPIANVGRLMKQILPQNAKISKEAKETMQECVSEFISFVTSEAS 83 >gb|AFK49666.1| nuclear transcription factor Y subunit B16 [Medicago truncatula] Length = 217 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 152 REQERLLPIANVGRIMKQNLPQNAKISKDAKETMQECVSEFIGFVTSEAS 3 +EQ+RLLPIANVGRIMKQ LPQNAKISK++KETMQECVSEFI FVTSEAS Sbjct: 21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEAS 70 >gb|AFK36846.1| unknown [Medicago truncatula] Length = 129 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 152 REQERLLPIANVGRIMKQNLPQNAKISKDAKETMQECVSEFIGFVTSEAS 3 +EQ+RLLPIANVGRIMKQ LPQNAKISK++KETMQECVSEFI FVTSEAS Sbjct: 21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEAS 70 >ref|XP_003609646.1| Nuclear transcription factor Y subunit B-5 [Medicago truncatula] gi|355510701|gb|AES91843.1| Nuclear transcription factor Y subunit B-5 [Medicago truncatula] Length = 216 Score = 89.4 bits (220), Expect = 3e-16 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 152 REQERLLPIANVGRIMKQNLPQNAKISKDAKETMQECVSEFIGFVTSEAS 3 +EQ+RLLPIANVGRIMKQ LPQNAKISK++KETMQECVSEFI FVTSEAS Sbjct: 20 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEAS 69